| Clone Name | baal5l06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1919_SYNY3 (P73121) Hypothetical protein slr1919 | 46 | 9e-05 | 2 | EF1B2_CAEEL (Q9U2H9) Probable elongation factor 1-beta/1-delta 2... | 32 | 1.4 | 3 | EF1B1_CAEEL (P34460) Probable elongation factor 1-beta/1-delta 1... | 32 | 1.4 | 4 | EF1B_ARTSA (P12262) Elongation factor 1-beta (EF-1-beta) | 32 | 1.8 | 5 | AXN_XENLA (Q9YGY0) Axin (Axis inhibition protein) (xAxin) | 29 | 9.0 |
|---|
>Y1919_SYNY3 (P73121) Hypothetical protein slr1919| Length = 566 Score = 45.8 bits (107), Expect = 9e-05 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 2/93 (2%) Frame = +3 Query: 57 VSSQKLEKKLDLTDTIKDGARLFLIDSGI--RRQLVMAFTEDSRLHVDELVDVYKLVEDQ 230 +S + + K DL T + G + + G+ RRQ+++A TED RLH DE+ ++ LV+D Sbjct: 478 LSIARSDTKFDLLPTAQLGLQFLFSEEGLYLRRQILLALTEDDRLHTDEVQRIWGLVKDD 537 Query: 231 IDIPSVALEVLQDLPSVARDFMLSWSDSVLSDR 329 E++ + R+F L+ ++L R Sbjct: 538 FK----PQELVNVAWNAVREFSLAGVSTILPQR 566
>EF1B2_CAEEL (Q9U2H9) Probable elongation factor 1-beta/1-delta 2| (EF-1-beta/delta 2) Length = 262 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +3 Query: 66 QKLEKKLDLTDTIKDGARLFLIDSGIRRQLVMAFTEDSRLHVDELVD 206 +KL + +++ + GA+L I GI++ ++ ED ++ VD+L++ Sbjct: 195 EKLVRSIEMDGLVWGGAKLIPIGYGIKKLQIITVIEDLKVSVDDLIE 241
>EF1B1_CAEEL (P34460) Probable elongation factor 1-beta/1-delta 1| (EF-1-beta/delta 1) Length = 213 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +3 Query: 66 QKLEKKLDLTDTIKDGARLFLIDSGIRRQLVMAFTEDSRLHVDELVD 206 +KL + +++ + GA+L I GI++ ++ ED ++ VD+L++ Sbjct: 146 EKLVRSIEMDGLVWGGAKLIPIGYGIKKLQIITVIEDLKVSVDDLIE 192
>EF1B_ARTSA (P12262) Elongation factor 1-beta (EF-1-beta)| Length = 206 Score = 31.6 bits (70), Expect = 1.8 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = +3 Query: 66 QKLEKKLDLTDTIKDGARLFLIDSGIRRQLVMAFTEDSRLHVDELVDVYKLVEDQIDIPS 245 +KL + + + + A+L + GI++ +M ED ++ +DEL + ED + Sbjct: 140 EKLVRSVQMDGLVWGAAKLIPLAYGIKKLSIMCVVEDDKVSIDELQEKISEFEDFVQSVD 199 Query: 246 VA 251 +A Sbjct: 200 IA 201
>AXN_XENLA (Q9YGY0) Axin (Axis inhibition protein) (xAxin)| Length = 842 Score = 29.3 bits (64), Expect = 9.0 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = +3 Query: 27 PALKSNSLETVSSQKLEKKLDLTDTIKDGARLFLIDSGIRRQLVMAFTEDSRLHVDELVD 206 P +N E S + LTD+ DG + + RR++ + + R + + Sbjct: 314 PVTSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKHYRREMQESANANGRGPLPHIPR 373 Query: 207 VYKLVED-QIDIPSVALEVLQDLPSVARD 290 Y + +D +D A E++ L V RD Sbjct: 374 TYHMPKDIHVDPEKFAAELISRLEGVLRD 402 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,727,764 Number of Sequences: 219361 Number of extensions: 1777694 Number of successful extensions: 4483 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4483 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)