| Clone Name | baal4p17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHO2_SCHPO (O74787) Phosphatidylethanolamine N-methyltransferase... | 33 | 0.65 | 2 | SHPI_STAHY (Q08002) Neutral metalloprotease precursor (EC 3.4.24.-) | 32 | 2.5 | 3 | ADC_CLOAB (P23670) Acetoacetate decarboxylase (EC 4.1.1.4) (ADC)... | 30 | 7.2 |
|---|
>CHO2_SCHPO (O74787) Phosphatidylethanolamine N-methyltransferase (EC 2.1.1.17)| (PEAMT) Length = 905 Score = 33.5 bits (75), Expect = 0.65 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -2 Query: 502 LHHAELNLRGTG--LHIPTMVVLVGPVNFQF*N*YACVILFLKNISIFYYVVRTQTYYHE 329 ++HA L+ RG +P LVG VNF F +L + SIF ++ + ++Y + Sbjct: 347 INHARLSPRGEDNEFELPPEHDLVGFVNFDFTRISDVALLIIALYSIFIILLSSNSHYSQ 406 Query: 328 LWSFSNKF 305 W+ F Sbjct: 407 FWAIFQAF 414
>SHPI_STAHY (Q08002) Neutral metalloprotease precursor (EC 3.4.24.-)| Length = 438 Score = 31.6 bits (70), Expect = 2.5 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 686 DYHHLILSHSDITTHAVSSSPSRLQDNTFKASTLPNM 576 D H I+++ DI +A SS L+ N FK ST+ +M Sbjct: 27 DAHTYIINNEDINKNAQESSIGTLKQNNFKQSTIDSM 63
>ADC_CLOAB (P23670) Acetoacetate decarboxylase (EC 4.1.1.4) (ADC) (AAD)| Length = 244 Score = 30.0 bits (66), Expect = 7.2 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -1 Query: 659 SDITTHAVSSSPSRLQDNTFKASTLPNMP---LLLSIHFLLDIELPSRAVI 516 +D+T H + P+RLQ + L ++P ++ S H L DI LP VI Sbjct: 189 TDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVI 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,319,550 Number of Sequences: 219361 Number of extensions: 2143140 Number of successful extensions: 4765 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4760 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)