| Clone Name | baal5a22 |
|---|---|
| Clone Library Name | barley_pub |
>SCC12_ARATH (Q9FQ20) Sister chromatid cohesion 1 protein 2 (SCC1 homolog 2)| (AtRAD21-1) Length = 810 Score = 47.0 bits (110), Expect = 3e-05 Identities = 20/44 (45%), Positives = 34/44 (77%) Frame = +2 Query: 2 LVHGKTRKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKPVSK 133 L G+T+KE++R+F+ETLVL TK Y++V+Q +P+ + + VS+ Sbjct: 762 LCRGRTQKESARLFYETLVLKTKGYVEVKQNHPYSDVFLMRVSR 805
>SCC13_ARATH (Q9FQ19) Sister chromatid cohesion 1 protein 3 (SCC1 homolog 3)| (AtRAD21-2) Length = 693 Score = 41.6 bits (96), Expect = 0.001 Identities = 20/40 (50%), Positives = 29/40 (72%) Frame = +2 Query: 2 LVHGKTRKEASRMFFETLVLSTKDYIQVEQVNPFDLINVK 121 ++ GKTRK A+RMFFETLVL ++ I ++Q P+ I +K Sbjct: 643 ILAGKTRKLAARMFFETLVLKSRGLIDMQQDRPYGDIALK 682
>REC8L_MOUSE (Q8C5S7) Meiotic recombination protein REC8-like 1 (Cohesin Rec8p)| Length = 591 Score = 33.9 bits (76), Expect = 0.27 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +2 Query: 20 RKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKPVSK 133 RK ASR+F+ LVLST+ + VEQ P+ + ++P K Sbjct: 552 RKLASRVFYLLLVLSTQKILLVEQQKPYGPLLIRPGPK 589
>RAD21_SCHPO (P30776) Cohesin subunit rad21 (Double-strand-break repair protein| rad21) (SCC1 homolog) Length = 628 Score = 33.5 bits (75), Expect = 0.35 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 11 GKTRKEASRMFFETLVLSTKDYIQVEQ 91 G R+EA ++FF+ LVL+TKD I V+Q Sbjct: 581 GCNREEAVQLFFDVLVLATKDVISVKQ 607
>REC8L_HUMAN (O95072) Meiotic recombination protein REC8-like 1 (Cohesin Rec8p)| Length = 547 Score = 29.3 bits (64), Expect = 6.7 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 20 RKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKP 124 R+ A+R+F+ LVLS + + V+Q P+ + ++P Sbjct: 508 RRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQP 542
>SUCC_CHLCV (Q822A1) Succinyl-CoA synthetase beta chain (EC 6.2.1.5) (SCS-beta)| Length = 388 Score = 28.9 bits (63), Expect = 8.7 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +1 Query: 1 ASAWEDSERSFKDVLRDLGVVDEGLHSGGAGE 96 AS+ E+ +++ K++ D GVV +H+GG G+ Sbjct: 25 ASSVEEGQQALKELAIDAGVVKVQVHAGGRGK 56
>SCC1_YEAST (Q12158) Sister chromatid cohesion protein 1| Length = 566 Score = 28.9 bits (63), Expect = 8.7 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 17 TRKEASRMFFETLVLSTKDYIQVEQVNPFDLINV 118 T++EASR FF+ L L+T+ I + Q F I + Sbjct: 520 TKREASRGFFDILSLATEGCIGLSQTEAFGNIKI 553 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,976,006 Number of Sequences: 219361 Number of extensions: 1295460 Number of successful extensions: 3590 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3590 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)