ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal3p15 |
|---|---|
| Clone Library Name | barley_pub |
>ASO_CUCSA (P14133) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 587 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMVFAVENGTTADSMLPP 102 +W FHCH++ H+ MG+G+VFA G M+PP Sbjct: 538 VWAFHCHIEPHLHMGMGVVFA--EGVHMVGMIPP 569
>LAC5_TRAVE (Q12717) Laccase 5 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) (Laccase IV) Length = 527 Score = 38.1 bits (87), Expect = 0.005 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +VFA + TA S P P A Sbjct: 477 WFLHCHIDFHLDAGFAIVFAEDTADTA-SANPVPTA 511
>LAC1_PLEOS (Q12729) Laccase 1 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 529 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ +GL +VFA + S+ PP A Sbjct: 478 WFLHCHIDWHLEIGLAVVFAED----VTSITAPPAA 509
>ASO_CUCMA (P24792) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 579 Score = 37.4 bits (85), Expect = 0.009 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMVFA 63 +W FHCH++ H+ MG+G+VFA Sbjct: 532 VWAFHCHIEPHLHMGMGVVFA 552
>LAC3_TRAVI (Q99049) Laccase 3 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 473 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPAD 114 WF HCH+D H+ GL +VFA + T ++ P P D Sbjct: 423 WFLHCHIDFHLQAGLAIVFAEDAQDT--KLVNPVPED 457
>ASO_CUCPM (P37064) L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase) (ASO)| Length = 552 Score = 37.4 bits (85), Expect = 0.009 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMVFA 63 +W FHCH++ H+ MG+G+VFA Sbjct: 502 VWAFHCHIEPHLHMGMGVVFA 522
>ASO_TOBAC (Q40588) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 578 Score = 37.0 bits (84), Expect = 0.012 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMVFA 63 +W FHCH++ H+ MG+G++FA Sbjct: 529 VWAFHCHIEPHLHMGMGVIFA 549
>LAC2_PLEOS (Q12739) Laccase 2 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 533 Score = 37.0 bits (84), Expect = 0.012 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ +GL +VFA + S+ PP A Sbjct: 480 WFLHCHIDWHLEIGLAVVFAED----VTSISAPPAA 511
>LAC4_TRAVI (Q99055) Laccase 4 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 520 Score = 35.4 bits (80), Expect = 0.035 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLP 99 WF HCH+D H+ G +VF+ + +++ P Sbjct: 470 WFLHCHIDFHLEAGFAIVFSEDTADVSNTTTP 501
>LAC4_TRAVE (Q12719) Laccase 4 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 520 Score = 35.4 bits (80), Expect = 0.035 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLP 99 WF HCH+D H+ G +VF+ + +++ P Sbjct: 470 WFLHCHIDFHLEAGFAIVFSEDTADVSNTTTP 501
>LAC2_AGABI (Q12542) Laccase-2 precursor (EC 1.10.3.2) (Laccase II)| (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 520 Score = 35.0 bits (79), Expect = 0.045 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFA 63 WF HCH+D H+ GL +VFA Sbjct: 467 WFLHCHIDWHLEAGLAIVFA 486
>LAC1_AGABI (Q12541) Laccase-1 precursor (EC 1.10.3.2) (Laccase I)| (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 520 Score = 35.0 bits (79), Expect = 0.045 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFA 63 WF HCH+D H+ GL +VFA Sbjct: 467 WFLHCHIDWHLEAGLAIVFA 486
>LAC3_THACU (Q02079) Laccase 3 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 572 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFA 63 WF HCH+D H+ G MVFA Sbjct: 519 WFLHCHIDWHLEEGFAMVFA 538
>LAC1_THACU (P56193) Laccase 1 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 576 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFA 63 WF HCH+D H+ G MVFA Sbjct: 520 WFLHCHIDWHLEEGFAMVFA 539
>LAC2_THACU (Q02075) Laccase 2 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 599 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFA 63 WF HCH+D H+ G MVFA Sbjct: 546 WFLHCHIDWHLEEGFAMVFA 565
>FET3_YEAST (P38993) Iron transport multicopper oxidase FET3 precursor (EC| 1.-.-.-) Length = 636 Score = 34.7 bits (78), Expect = 0.059 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMV 57 +WFFHCH++ H+ GLG+V Sbjct: 479 VWFFHCHIEWHLLQGLGLV 497
>YD506_YEAST (Q04399) Putative multicopper oxidase YDR506C (EC 1.-.-.-)| Length = 608 Score = 34.7 bits (78), Expect = 0.059 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADS 90 W HCH++ H+ GLG+VF V TT DS Sbjct: 527 WLLHCHVEWHMMKGLGIVFEVPT-TTEDS 554
>COPA1_TRAVI (Q99056) Laccase 5 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) Length = 527 Score = 34.7 bits (78), Expect = 0.059 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +V+ + TA S P P A Sbjct: 477 WFLHCHIDFHLEAGFAIVWGEDTADTA-SANPVPTA 511
>FET5_YEAST (P43561) Iron transport multicopper oxidase FET5 precursor (EC| 1.-.-.-) Length = 622 Score = 34.3 bits (77), Expect = 0.078 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMVF 60 +W+FHCH+D H+ GL VF Sbjct: 492 VWYFHCHVDWHLQQGLASVF 511
>LAC2_TRAVI (Q99046) Laccase 2 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 519 Score = 34.3 bits (77), Expect = 0.078 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +VFA E+ + P P A Sbjct: 469 WFLHCHIDFHLDAGFAIVFA-EDVADVKAANPVPKA 503
>LAC2_TRAVE (Q12718) Laccase 2 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) (Laccase I) Length = 519 Score = 34.3 bits (77), Expect = 0.078 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +VFA E+ + P P A Sbjct: 469 WFLHCHIDFHLDAGFAIVFA-EDVADVKAANPVPKA 503
>LAC1_TRAVI (Q99044) Laccase 1 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) Length = 520 Score = 34.3 bits (77), Expect = 0.078 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +VFA E+ S P P A Sbjct: 470 WFLHCHIDFHLEAGFAVVFA-EDIPDVASANPVPQA 504
>LAC1_TRAHI (Q02497) Laccase precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Ligninolytic phenoloxidase) Length = 520 Score = 34.3 bits (77), Expect = 0.078 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPA 111 WF HCH+D H+ G +VFA E+ S P P A Sbjct: 470 WFLHCHIDFHLEAGFAVVFA-EDIPDVASANPVPQA 504
>LAC1_PHLRA (Q01679) Laccase precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Ligninolytic phenoloxidase) Length = 520 Score = 34.3 bits (77), Expect = 0.078 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTADSMLPPPPAD 114 WF HCH+D H+ G +VFA + A + P P D Sbjct: 470 WFLHCHIDWHLEAGFAVVFAEDIPDVAS--INPVPQD 504
>LAC1_PYCCI (O59896) Laccase precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Ligninolytic phenoloxidase) Length = 518 Score = 33.9 bits (76), Expect = 0.10 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVFAVENGTTA 84 WF HCH+D H+ G +V A + TA Sbjct: 468 WFLHCHIDFHLEAGFAVVLAEDTPDTA 494
>FET3_CANAL (P78591) Iron transport multicopper oxidase FET3 precursor (EC| 1.-.-.-) Length = 624 Score = 33.9 bits (76), Expect = 0.10 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMV 57 +WFFHCH+D H+ GL +V Sbjct: 477 VWFFHCHVDWHLEQGLAVV 495
>FET3_CANGA (Q96WT3) Iron transport multicopper oxidase FET3 precursor (EC| 1.-.-.-) Length = 635 Score = 32.0 bits (71), Expect = 0.38 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMV 57 +WFFHCH++ H+ GL +V Sbjct: 479 VWFFHCHIEWHLLQGLAVV 497
>FET3_KLULA (Q6CII3) Iron transport multicopper oxidase FET3 precursor (EC| 1.-.-.-) Length = 631 Score = 32.0 bits (71), Expect = 0.38 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 1 MWFFHCHLDAHVPMGLGMV 57 +WFFHCH++ H+ GL ++ Sbjct: 484 VWFFHCHIEWHLKQGLALL 502
>LAC1_CRYPA (Q03966) Laccase precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) Length = 591 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVF 60 W HCH+ HV GLG F Sbjct: 530 WLMHCHIAWHVSAGLGNTF 548
>LPXH_XYLFA (Q9PAD0) UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.-)| Length = 250 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -3 Query: 286 IHVHVHHK--HTRQINERSCTRI 224 IH H H HT Q+ ER+CTR+ Sbjct: 200 IHGHTHRPALHTLQVAERTCTRV 222
>LAC1_MELAO (Q70KY3) Laccase-1 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Ligninolytic phenoloxidase) Length = 623 Score = 28.1 bits (61), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVF 60 W FHCH+ HV GL + F Sbjct: 549 WLFHCHIAWHVSGGLSVDF 567
>NCOA2_XENLA (Q9W705) Nuclear receptor coactivator 2 (NCoA-2) (Transcriptional| intermediary factor 2) (xTIF2) Length = 1516 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 113 SAGGGGSMESAVVPFSTANTIPSPIGTCAS 24 S G GS A PFS A ++ SP+ C+S Sbjct: 483 SPGVAGSPRIAPSPFSPAGSLHSPVSVCSS 512
>K0040_HUMAN (Q15053) Protein KIAA0040| Length = 153 Score = 23.5 bits (49), Expect(2) = 8.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 205 THTKNN*FCKFAGKTMMKSRWKLA 134 THT N ++ GK ++ +W LA Sbjct: 88 THTHTNSGSRYVGKYILLIKWSLA 111 Score = 22.7 bits (47), Expect(2) = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 301 VTPNPIHVHVHHKHT 257 + P +H+HV H HT Sbjct: 78 MVPKCVHMHVTHTHT 92
>PSD_BARHE (Q6G5G6) Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65)| [Contains: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] Length = 232 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = +2 Query: 263 FMVNVYMDWVW-----CNNVLFLWCKY 328 F++++ + WVW C VL +WC Y Sbjct: 26 FVISLILGWVWSPLFWCGLVLTVWCIY 52
>LAC2_PODAN (P78722) Laccase-2 precursor (EC 1.10.3.2) (Laccase II)| (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase) (Diphenol oxidase) (Laccase C) Length = 621 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 4 WFFHCHLDAHVPMGLGMVF 60 W FHCH+ HV GL + + Sbjct: 545 WLFHCHIAWHVSGGLSVQY 563
>PSC_DROME (P35820) Polycomb group protein Psc (Protein posterior sex combs)| Length = 1601 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 122 TGRSAGGGGSMESAVVPFSTANTIPSPIGT 33 T + GGGG +E + P T+PSP T Sbjct: 1510 TAAATGGGGPVEGELKPMLPTVTLPSPGAT 1539 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,446,618 Number of Sequences: 219361 Number of extensions: 881563 Number of successful extensions: 2516 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 2452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2514 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
