| Clone Name | baal4b13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PO121_RAT (P52591) Nuclear envelope pore membrane protein POM 12... | 30 | 6.0 | 2 | YFG8_YEAST (P43536) Hypothetical 18.6 kDa protein in COS4 5'region | 30 | 7.9 |
|---|
>PO121_RAT (P52591) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) (P145) Length = 1199 Score = 30.0 bits (66), Expect = 6.0 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = -3 Query: 625 LDMPTM*FASFPASFPVP*VGS--DSHRRRPSWPCREAPTPPECWCATLYTISPPRGKTA 452 L +PT+ A+ PAS P P +S ++ P + PPE AT+ SPP+ + Sbjct: 550 LTLPTVGPAASPASLPAPSSNPLLESLKKMQESPAPSSSEPPE--AATVAAPSPPKTPSL 607 Query: 451 LVVLV 437 L LV Sbjct: 608 LAPLV 612
>YFG8_YEAST (P43536) Hypothetical 18.6 kDa protein in COS4 5'region| Length = 160 Score = 29.6 bits (65), Expect = 7.9 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 418 PTTSASILRPLERSCRVEEISCTVLRTSTLEESVLLCMARMD--AFYVNRFQL 570 P+ A L PL SCR++ +C ++ S++ R+D FY +FQ+ Sbjct: 80 PSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRVDLSPFYAKKFQI 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,607,731 Number of Sequences: 219361 Number of extensions: 1960040 Number of successful extensions: 5803 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5803 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)