| Clone Name | baal3l23 |
|---|---|
| Clone Library Name | barley_pub |
>Y443_MYCPN (P75335) Probable ATP-dependent RNA helicase MG308 homolog (EC| 3.6.1.-) (H08_orf409) Length = 409 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 6/37 (16%) Frame = +3 Query: 153 MCHLSQHDKFLGILLLMNFHHT------CSDKKTLKK 245 + +L+ + F G+L L+N+HH CS+ K+LK+ Sbjct: 195 LLNLNGQEPFAGLLALLNYHHNEQVLVFCSNAKSLKQ 231
>MEU27_SCHPO (O94713) Meiotic expression up-regulated protein 27| Length = 736 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 153 SISQDWILAYEKPYK-ASSVNSNVQNDAKARVSTSFPEK 40 S+SQ W AY K +SS NSN++ AR + PEK Sbjct: 154 SLSQYWNAAYNKKESISSSTNSNIKLHLAARKYQTKPEK 192
>FBF2_CAEEL (Q09312) Fem-3 mRNA-binding factor 2| Length = 632 Score = 28.1 bits (61), Expect = 5.2 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = -3 Query: 353 CCSNPSGRTKRKWGQYGGRLSF-SWICLAHCLVDEE-PLLQRFLVAAGVVE-VHQQQNT* 183 CC SGR + K G Y +SF W+ H V +E L RF ++E + ++T Sbjct: 510 CCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRSTH 569 Query: 182 ELVMLREMTHLYHKTGFLHMKS 117 + L+ H KT + S Sbjct: 570 PIYELQSSGHDSFKTDYFSTAS 591
>TLE1_XENLA (O42469) Enhancer of split groucho-like protein 1| Length = 767 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 146 HKTGFLHMKSHTKPAPLTPMFRMMQRPG 63 H+ H+ H P PLTP +Q PG Sbjct: 144 HQLQAQHLSHHAPPIPLTPHPSSLQHPG 171
>ACVS2_PENCH (P26046) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase| (EC 6.3.2.26) (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS) Length = 3791 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 186 GILLLMNFHHTCSDKKTLK 242 G+ L++ FHHTC D +LK Sbjct: 2152 GLYLILAFHHTCFDAWSLK 2170
>HAM_DROME (Q8I7Z8) Transcription factor hamlet| Length = 990 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 314 PIFSSSGPMDLSNSSPVITDPI 379 P+F S PMDL P IT P+ Sbjct: 489 PMFFSKNPMDLGCGGPEITSPV 510
>BCTN5_CAPHI (P82018) Bactenecin-5 precursor (Bac5) (ChBac5) (Cathelicidin-2)| Length = 176 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 101 PLTPMFRMMQRPGFQPPFR 45 P P FR RP F+PPFR Sbjct: 144 PFNPPFRPPVRPPFRPPFR 162
>ACVS1_PENCH (P19787) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase| (EC 6.3.2.26) (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS) Length = 3746 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 186 GILLLMNFHHTCSDKKTLK 242 G+ L++ FHHTC D +LK Sbjct: 2120 GLYLILAFHHTCFDAWSLK 2138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,419,516 Number of Sequences: 219361 Number of extensions: 1208503 Number of successful extensions: 3072 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3072 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)