| Clone Name | baal4a20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y2677_METMA (Q8PTN6) Hypothetical UPF0337 protein MM2677 | 29 | 2.8 | 2 | STRO_STRGR (P29785) Glucose-1-phosphate thymidylyltransferase (E... | 29 | 3.7 | 3 | NAB2_MOUSE (Q61127) NGFI-A-binding protein 2 (EGR-1-binding prot... | 28 | 4.8 | 4 | NAB2_HUMAN (Q15742) NGFI-A-binding protein 2 (EGR-1-binding prot... | 28 | 4.8 |
|---|
>Y2677_METMA (Q8PTN6) Hypothetical UPF0337 protein MM2677| Length = 59 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -3 Query: 166 LRSRFSPRRGDPLSLARSLRIETGEARKGETKKRRGSEGERVGEARSRW 20 + +FS +G+ A + + KGE +KR+G E+VG+ R + Sbjct: 9 MEGKFSKAKGEIKESAGEMTGDIEMEAKGEAEKRKGEAQEKVGKIRKEF 57
>STRO_STRGR (P29785) Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)| (dTDP-glucose synthase) Length = 259 Score = 28.9 bits (63), Expect = 3.7 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 163 RSRFSPRRGDPLSLARSLRIETGEARKGETKKRRG--SEGERVGEARSRWRWVEAA 2 R F+ RG+PLS AR LRI + E + G V R R RWVE++ Sbjct: 132 RGAFTSVRGEPLSAARPLRIPSAPLPL-EAARVGGFLMPDSPVEPVRDRMRWVESS 186
>NAB2_MOUSE (Q61127) NGFI-A-binding protein 2 (EGR-1-binding protein 2)| Length = 525 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 103 ETGEARKGETKKRRGSEGERVGEARS 26 ET RKG GS GE+ G ARS Sbjct: 132 ETAGTRKGSMSNGHGSPGEKAGSARS 157
>NAB2_HUMAN (Q15742) NGFI-A-binding protein 2 (EGR-1-binding protein 2)| (Melanoma-associated delayed early response protein) (MADER protein) Length = 525 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 103 ETGEARKGETKKRRGSEGERVGEARS 26 ET RKG GS GE+ G ARS Sbjct: 132 ETAGTRKGSMSNGHGSPGEKAGSARS 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.126 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,179,873 Number of Sequences: 219361 Number of extensions: 183064 Number of successful extensions: 416 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)