ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal3i09 |
|---|---|
| Clone Library Name | barley_pub |
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 126 bits (317), Expect = 1e-29 Identities = 57/69 (82%), Positives = 61/69 (88%) Frame = +1 Query: 121 FVVRASSXXPAKQNDNRQLWFAXKQSLTYLDGTLPGDFGFDPLGLSDPEGTGGFIEPRWL 300 FVVRA+S P KQ NRQLWFA KQSL+YLDG LPGDFGFDPLGLSDPEGTGGFIEP+WL Sbjct: 37 FVVRAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGLSDPEGTGGFIEPKWL 96 Query: 301 AYGEIFNGR 327 AYGE+ NGR Sbjct: 97 AYGEVINGR 105
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 52.4 bits (124), Expect = 3e-07 Identities = 29/71 (40%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +1 Query: 118 PFVVRASSXXPAKQNDNRQLWFAXKQSLTYLDGTLPGDFGFDPLGL-SDPEGTGGFIEPR 294 P R+ + + +R LWF +LDG+LPGDFGFDPLGL SDPE + Sbjct: 48 PVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESL------K 101 Query: 295 WLAYGEIFNGR 327 W A E+ + R Sbjct: 102 WNAQAELVHSR 112
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 50.4 bits (119), Expect = 1e-06 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 130 RASSXXPAKQNDNRQLWFAXKQSLTYLDGTLPGDFGFDPLGL-SDPEGTGGFIEPRWLAY 306 R+++ + +R LWF +LDG+LPGDFGFDPLGL SDPE RW Sbjct: 52 RSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESL------RWNQQ 105 Query: 307 GEIFNGR 327 E+ + R Sbjct: 106 AELVHCR 112
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 166 NRQLWFAXKQSLTYLDGTLPGDFGFDPLGLSDP 264 +R LWF +S YLDG+L GD+GFDP GL P Sbjct: 51 DRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKP 83
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 43.1 bits (100), Expect = 2e-04 Identities = 30/76 (39%), Positives = 39/76 (51%), Gaps = 7/76 (9%) Frame = +1 Query: 121 FVVRASSXXPAKQNDNRQLWFAXKQS------LTYLDGTLPGDFGFDPLGL-SDPEGTGG 279 FVV A++ P K W +S +LDG+LPGDFGFDPLGL DP Sbjct: 42 FVVAAAAVAPKKS------WIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDP----A 91 Query: 280 FIEPRWLAYGEIFNGR 327 F+ +W E+ +GR Sbjct: 92 FL--KWYREAELIHGR 105
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 42.4 bits (98), Expect = 3e-04 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 178 WFAXKQSLTYLDGTLPGDFGFDPLGLS-DPEGTGGFIEPRWLAYGEIFNGR 327 W S YL G+L GD GFDPLGL+ DPE +W E+ NGR Sbjct: 57 WLPGLASPDYLTGSLAGDNGFDPLGLAEDPENL------KWFVQAELVNGR 101
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 41.6 bits (96), Expect = 5e-04 Identities = 22/42 (52%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 205 YLDGTLPGDFGFDPLGL-SDPEGTGGFIEPRWLAYGEIFNGR 327 +LDG+LPGDFGFDPLGL DP F+ +W E+ +GR Sbjct: 75 WLDGSLPGDFGFDPLGLGKDP----AFL--KWYREAELIHGR 110
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 40.8 bits (94), Expect = 8e-04 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +1 Query: 166 NRQLWFAXKQSLTYLDGTLPGDFGFDPLGLSDP 264 +R LW+ S +LDG+L GD+GFDP GL P Sbjct: 54 DRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKP 86
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 40.8 bits (94), Expect = 8e-04 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = +1 Query: 175 LWFAXKQSLTYLDGTLPGDFGFDPLGLSDP 264 LW +LDG+LPGD GFDPLGLS P Sbjct: 51 LWLPNTTRPEWLDGSLPGDRGFDPLGLSKP 80
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 40.4 bits (93), Expect = 0.001 Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 205 YLDGTLPGDFGFDPLGL-SDPEGTGGFIEPRWLAYGEIFNGR 327 +LDG+LPGD+GFDPLGL DP F+ +W E+ +GR Sbjct: 70 WLDGSLPGDYGFDPLGLGKDP----AFL--KWYREAELIHGR 105
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 178 WFAXKQSLTYLDGTLPGDFGFDPLGLSD 261 W + +YLDG+ PGDFGFD LGL + Sbjct: 49 WMPGQPRPSYLDGSAPGDFGFDSLGLGE 76
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 154 KQNDNRQLWFAXKQSLTYLDGTLPGDFGFDPLGLSDP 264 + + +R +WF +LDG++ GD GFDP GL P Sbjct: 51 QDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKP 87
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 33.9 bits (76), Expect = 0.10 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPEGTGGFIEPRWLAYGEIFNGR 327 Q+ +YL+G PGD+G+D GLS DPE F + R L E+ +GR Sbjct: 62 QTPSYLNGEFPGDYGWDTAGLSADPE---AFAKNRAL---EVIHGR 101
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 33.5 bits (75), Expect = 0.14 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 9/59 (15%) Frame = +1 Query: 166 NRQLW---FAXKQSLTYLDGTLPGDFGFDPLGLS-DPEGTGGF-----IEPRWLAYGEI 315 NR W ++ + YL G PGD+G+D GLS DPE + I RW G + Sbjct: 40 NRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGAL 98
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 33.5 bits (75), Expect = 0.14 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPEGTG-----GFIEPRWLAYGEI 315 Q+ +YL+G PGD+G+D GLS DPE I RW G + Sbjct: 65 QTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGAL 111
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 33.1 bits (74), Expect = 0.18 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 11/57 (19%) Frame = +1 Query: 130 RASSXXPAKQNDNRQLWFAXKQSL----------TYLDGTLPGDFGFDPLGLS-DPE 267 R P + + +W+ + L +YL G PGD+G+D GLS DPE Sbjct: 33 RVQMMAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPE 89
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 163 DNRQLWFAXKQSLTYLDGTLPGDFGFDPLGL-SDP 264 + R+LWF YL G GD GFDP GL +DP Sbjct: 369 EERELWFPNIVPPRYLTGEAYGDKGFDPAGLAADP 403 Score = 32.3 bits (72), Expect = 0.30 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 175 LWFAXKQSLTYLDGTLPGDFGFDPLGL-SDPEGTGGFIEPRWLAYGEIFNGR 327 LWF + L G P D GFDPL L +DP+ + R + E+F+GR Sbjct: 189 LWFPNAEPPALLTGEYPADRGFDPLNLAADPD-----VYAR-MRVAEVFHGR 234 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 175 LWFAXKQSLTYLDGTLPGDFGFDPLGL-SDPE 267 LWF + ++L+G GD GFDP GL +DP+ Sbjct: 4 LWFPNTLAPSWLNGEYYGDRGFDPAGLAADPD 35
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 63 EQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 63 EQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 63 EQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 62 EQTPSYLTGEFPGDYGWDTAGLSADPE 88
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 61 EQTPSYLTGEFPGDYGWDTAGLSADPE 87
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 35 EQTPSYLTGEFPGDYGWDTAGLSADPE 61
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q+ +YL G PGD+G+D GLS DPE Sbjct: 62 EQTPSYLTGEFPGDYGWDTAGLSADPE 88
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 66 ESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 66 ESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 66 ESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 66 ESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 66 ESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 65 ESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 65 ESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 32.3 bits (72), Expect = 0.30 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 6/51 (11%) Frame = +1 Query: 181 FAXKQSLTYLDGTLPGDFGFDPLGLS-DPEGTGGF-----IEPRWLAYGEI 315 F+ + YL G PGD+G+D GLS DP+ + I RW G + Sbjct: 45 FSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGAL 95
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 64 ESPSYLTGEFPGDYGWDTAGLSADPE 89
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 67 ESPSYLTGEFPGDYGWDTAGLSADPE 92
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 64 ESPSYLTGEFPGDYGWDTAGLSADPE 89
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 65 ESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 63 ESPSYLTGEFPGDYGWDTAGLSADPE 88
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 32.3 bits (72), Expect = 0.30 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 11/50 (22%) Frame = +1 Query: 151 AKQNDNRQLWFAXKQSL----------TYLDGTLPGDFGFDPLGLS-DPE 267 AKQ + W+ + L +YL G PGD+G+D GLS DPE Sbjct: 41 AKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPE 90
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 65 ESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 68 ESPSYLTGEFPGDYGWDTAGLSADPE 93
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 193 QSLTYLDGTLPGDFGFDPLGLS-DPE 267 +S +YL G PGD+G+D GLS DPE Sbjct: 27 ESPSYLTGEFPGDYGWDTAGLSADPE 52
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KQSLTYLDGTLPGDFGFDPLGLS-DPE 267 +Q +YL G PGD+G+D GLS DPE Sbjct: 63 EQIPSYLTGEFPGDYGWDTAGLSADPE 89
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 31.6 bits (70), Expect = 0.52 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = +1 Query: 205 YLDGTLPGDFGFDPLGLS-DPEGTGGF-----IEPRWLAYGEI 315 YL G PGD+G+D GLS DPE + I RW G + Sbjct: 58 YLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGAL 100
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 69 SYLTGEFPGDYGWDTAGLSADPE 91
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 69 SYLTGEFPGDYGWDTAGLSADPE 91
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 80 SYLTGEFPGDYGWDTAGLSADPE 102
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 80 SYLTGEFPGDYGWDTAGLSADPE 102
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 68 SYLTGEFPGDYGWDTAGLSADPE 90
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 66 SYLTGEFPGDYGWDTAGLSADPE 88
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 47 SYLTGEFPGDYGWDTAGLSADPE 69
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 63 SYLTGEFPGDYGWDTAGLSADPE 85
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 64 SYLTGEFPGDYGWDTAGLSADPE 86
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 65 SYLTGEFPGDYGWDTAGLSADPE 87
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 8 SYLTGEFPGDYGWDTAGLSADPE 30
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 76 SYLTGEFPGDYGWDTAGLSADPE 98
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 31.2 bits (69), Expect = 0.67 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 57 SYLTGEFPGDYGWDTAGLSADPE 79
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 30.8 bits (68), Expect = 0.88 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +1 Query: 205 YLDGTLPGDFGFDPLGL-SDPEGTGGF-----IEPRWLAYG 309 YL+G + GD+G+DP GL PE + I RW G Sbjct: 84 YLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLG 124
>FCP_ISOGA (Q39709) Fucoxanthin-chlorophyll a-c binding protein, chloroplast| precursor (FCP) Length = 208 Score = 30.8 bits (68), Expect = 0.88 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 211 DGTLPGDFGFDPLGL--SDPEGTGGFIEPRWLAYGEIFNGR 327 +G PGD GFDPLGL SDP+ E R + E+ +GR Sbjct: 145 EGYEPGDLGFDPLGLAPSDPD------EFRLMQEKELSHGR 179
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 175 LWFAXKQSLTYLDGTLPGDFGFDPLGL-SDP 264 +WF Q +L G P D GFDPL + +DP Sbjct: 161 VWFPGAQPPAHLTGEYPADRGFDPLSVAADP 191
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D GLS DPE Sbjct: 66 SYLTGEFPGDYGWDTEGLSADPE 88
>AROC_METKA (Q8TXN1) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 386 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 321 VEDLAVGQPPGLDEPAGALRVGQPQGVEAKVTRQRAVEVGEGL 193 +E +A PPGL +P G+ G + +AVEVG G+ Sbjct: 216 IEVIAENVPPGLGDPVFGRLDGELAGALMNIPAVKAVEVGSGV 258
>SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA| ligase 1) (GluRS 1) Length = 473 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 140 DDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPW 36 D+ K REE + K C P SC P R W Sbjct: 104 DEVAEKKAKAREEGKIYKHKCTTKPPSCHPSSRHW 138
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DP 264 +YL G PGD+G+D GLS DP Sbjct: 68 SYLTGEFPGDYGWDTAGLSADP 89
>AROC_WOLSU (Q7M841) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 360 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -1 Query: 324 AVEDLAVGQPPGLDEPAGALRVGQPQGVEAKVTRQRAVEVGEGL 193 A+E A G P GL EP G G + +AVE+GEGL Sbjct: 203 AIEVRAKGMPIGLGEPLYHKLDGALGGALMGLNAVKAVEIGEGL 246
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G P D+G+D GLS DPE Sbjct: 69 SYLTGEFPSDYGWDTAGLSADPE 91
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS 258 +YL G PGD+G+D GLS Sbjct: 71 SYLTGEFPGDYGWDTAGLS 89
>GUC2E_RAT (P51840) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 233 LASTPWGCPTRRAPAGSSSPGGWPTA 310 +A PWGCP RA AG+++P P A Sbjct: 148 VALVPWGCPGTRA-AGTTAPAVTPAA 172
>GUC2E_MOUSE (P52785) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 233 LASTPWGCPTRRAPAGSSSPGGWPTA 310 +A PWGCP RA AG+++P P A Sbjct: 148 VALVPWGCPGTRA-AGTTAPAVTPAA 172
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGL-SDPE 267 +YL+G GD+G+D GL SDPE Sbjct: 70 SYLNGEFAGDYGWDTAGLSSDPE 92
>MOD5_HUMAN (Q9H3H1) tRNA isopentenyltransferase, mitochondrial precursor (EC| 2.5.1.8) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPTase) (IPPT) (hGRO1) Length = 467 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 237 AKVTRQRAVEVGEGLLXREPQLPVVILLG 151 A V RAV VG GL + LP+V++LG Sbjct: 2 ASVAAARAVPVGSGLRGLQRTLPLVVILG 30
>GUC2D_CANFA (O19179) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2)| (Guanylate cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC) (Guanylate cyclase E) (GC-E) Length = 1109 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 233 LASTPWGCPTRRAPAGSSSPGGWPTA 310 +A PW CP RA G+++P G P A Sbjct: 149 VALVPWSCPGTRA-GGTTAPAGTPAA 173
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D LS DPE Sbjct: 69 SYLTGEFPGDYGWDTAELSADPE 91
>REP2_YEAST (P03872) Trans-acting factor C (REP2) (Protein charlie)| Length = 296 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Frame = -1 Query: 321 VEDLAVGQPPGLDEPAGALRVGQPQGVE-----AKVTRQRAVEVGEGLLXRE 181 +E L G+P GLD A V E AK+ ++R +G G+L + Sbjct: 58 MESLTTGRPYGLDSSAEDSSVSSDSSAEVILPAAKMVKERFDSIGNGMLSSQ 109
>OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein| CPn_1034/CP0818/CPj1034/CpB1074 precursor Length = 262 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 164 SFCLAGXMDDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPWAAIVP 21 +F L +DD L G+ + + +GL PE+ W A+VP Sbjct: 41 NFWLILDLDDTLLQGGEALSHSIWKSKAIQGLQKQGTPEQEAWEAVVP 88
>FBSH_HUMAN (Q9HAH7) Probable fibrosin-1 long transcript protein| Length = 372 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 247 LGLSDPEGTGGFIEPRWLA 303 LG S P+ GF+EP WLA Sbjct: 260 LGPSPPDRCAGFLEPTWLA 278
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +1 Query: 202 TYLDGTLPGDFGFDPLGLS-DPE 267 +YL G PGD+G+D +S DPE Sbjct: 68 SYLTGEFPGDYGWDTAAVSADPE 90
>GUC2D_BOVIN (P55203) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2)| (Guanylate cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC) (Guanylate cyclase E) (GC-E) Length = 1110 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 233 LASTPWGCPTRRAPAGSSSPGGWPTA 310 +A PWGCP RA AG+++P P A Sbjct: 150 VALVPWGCPGTRA-AGTTAPVVTPAA 174
>SALL2_MOUSE (Q9QX96) Sal-like protein 2 (Spalt-like protein 2) (MSal-2)| Length = 1004 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 227 VTLASTPWGCPTRRAPAGSSSPGG 298 V +AST G PT APA SSS G Sbjct: 604 VAVASTASGAPTTSAPAPSSSASG 627
>NAC3_RAT (P70549) Sodium/calcium exchanger 3 precursor| (Na(+)/Ca(2+)-exchange protein 3) Length = 927 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = -1 Query: 312 LAVGQPPGLDEPAGALRVGQPQGVEAKVTRQ-----RAVEVGEGLLXREPQLPVVI 160 +A+G+P ++ AL + P+ + K+T + R E+G+ +L P+L V+I Sbjct: 616 IALGEPKWMERGISALLLS-PEVTDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVII 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,370,022 Number of Sequences: 219361 Number of extensions: 649480 Number of successful extensions: 2720 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 2556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2720 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)
