| Clone Name | baal3h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU214_DROME (Q9W1X4) Nuclear pore complex protein Nup214 (Nucleo... | 29 | 3.1 | 2 | NAS35_CAEEL (P98060) Zinc metalloproteinase nas-35 precursor (EC... | 28 | 5.3 | 3 | ANDR_MOUSE (P19091) Androgen receptor (Dihydrotestosterone recep... | 28 | 7.0 | 4 | ANDR_RAT (P15207) Androgen receptor (Dihydrotestosterone receptor) | 28 | 9.1 |
|---|
>NU214_DROME (Q9W1X4) Nuclear pore complex protein Nup214 (Nucleoporin Nup214)| (214 kDa nucleoporin) (DNup214) Length = 1711 Score = 29.3 bits (64), Expect = 3.1 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 Query: 7 RGGLSSEASKQVXXRQXQWRWSPRSACSPMAGSRRTSQTGAPPSPP 144 R GL SE + R Q + R+A P ++ T APPSPP Sbjct: 862 RVGLKSEVILETKRRAEQIK---RAAAKPATANKYTQAAVAPPSPP 904
>NAS35_CAEEL (P98060) Zinc metalloproteinase nas-35 precursor (EC 3.4.24.21)| (Nematode astacin 35) (Dumpy protein 31) (Tollish protein 2) Length = 592 Score = 28.5 bits (62), Expect = 5.3 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +1 Query: 4 FRGGLSSEASKQVXXRQXQWR-WSPRSACSP---MAGSRRTSQTGAP 132 +RGG EA + W WSP +ACS GSR ++T P Sbjct: 474 YRGGKGFEARARAVPEAGNWNSWSPWTACSATCGACGSRMRTRTCPP 520
>ANDR_MOUSE (P19091) Androgen receptor (Dihydrotestosterone receptor)| Length = 899 Score = 28.1 bits (61), Expect = 7.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +1 Query: 10 GGLSSEASKQVXXRQXQWRWSPRSACSPMAGSRRTSQTGAPPSPP 144 G L+ E +Q +Q P S+C P G+ G P PP Sbjct: 85 GYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAPGKGLPQQPP 129
>ANDR_RAT (P15207) Androgen receptor (Dihydrotestosterone receptor)| Length = 902 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +1 Query: 10 GGLSSEASKQVXXRQXQWRWSPRSACSPMAGSRRTSQTGAPPSPP 144 G L+ E +Q +Q P S C P G+ G P PP Sbjct: 85 GYLALEEEQQPSQQQSASEGHPESGCLPEPGAATAPGKGLPQQPP 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.123 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,426,245 Number of Sequences: 219361 Number of extensions: 232627 Number of successful extensions: 743 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)