| Clone Name | baal2p10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MIAA_STAES (Q8CQL3) tRNA delta(2)-isopentenylpyrophosphate trans... | 28 | 7.2 | 2 | MIAA_STAEQ (Q5HPN8) tRNA delta(2)-isopentenylpyrophosphate trans... | 28 | 7.2 |
|---|
>MIAA_STAES (Q8CQL3) tRNA delta(2)-isopentenylpyrophosphate transferase (EC| 2.5.1.8) (IPP transferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPTase) (IPPT) Length = 332 Score = 28.5 bits (62), Expect = 7.2 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = +3 Query: 180 VLLILSSAALTETIDAFRMHVDQYATNLLEWYLLVLKNICHAHCYNEEKERGLVGVSGIT 359 V +I + ++ ++ + H QYA L W+ KN + H N+E+ + + IT Sbjct: 253 VPVIKGNISMENAVEKLKQHSRQYAKRQLTWF----KNKMNVHWLNKERMSLQMMLDEIT 308 Query: 360 S*ISK 374 + I+K Sbjct: 309 TQINK 313
>MIAA_STAEQ (Q5HPN8) tRNA delta(2)-isopentenylpyrophosphate transferase (EC| 2.5.1.8) (IPP transferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPTase) (IPPT) Length = 332 Score = 28.5 bits (62), Expect = 7.2 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = +3 Query: 180 VLLILSSAALTETIDAFRMHVDQYATNLLEWYLLVLKNICHAHCYNEEKERGLVGVSGIT 359 V +I + ++ ++ + H QYA L W+ KN + H N+E+ + + IT Sbjct: 253 VPVIKGNISMENAVEKLKQHSRQYAKRQLTWF----KNKMNVHWLNKERMSLQMMLDEIT 308 Query: 360 S*ISK 374 + I+K Sbjct: 309 TQINK 313 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,140,230 Number of Sequences: 219361 Number of extensions: 1217801 Number of successful extensions: 2519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2518 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)