| Clone Name | baal3d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YTHD1_HUMAN (Q9BYJ9) YTH domain protein 1 (Dermatomyositis assoc... | 31 | 1.7 | 2 | YTHD1_MOUSE (P59326) YTH domain protein 1 (Dermatomyositis assoc... | 30 | 3.7 |
|---|
>YTHD1_HUMAN (Q9BYJ9) YTH domain protein 1 (Dermatomyositis associated with| cancer putative autoantigen 1) (DACA-1) Length = 559 Score = 31.2 bits (69), Expect = 1.7 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -2 Query: 241 NQHETPTICRQEHLSSYYMMSGCSPYAGDGKQWASAGS--TPYFSTLGSV*LQTNTDRH 71 NQ + +LSSYY S PY+ + W++AG PY +T G + +N D H Sbjct: 43 NQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQL---SNGDHH 98
>YTHD1_MOUSE (P59326) YTH domain protein 1 (Dermatomyositis associated with| cancer putative autoantigen 1 homolog) (DACA-1 homolog) Length = 559 Score = 30.0 bits (66), Expect = 3.7 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 205 HLSSYYMMSGCSPYAGDGKQWASAGS--TPYFSTLGSV*LQTNTDRH 71 +LSSYY S PY+ W++AG PY +T G + +N D H Sbjct: 55 YLSSYYPPSIGFPYSLSEAPWSTAGDPPIPYLTTYGQL---SNGDHH 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,124,991 Number of Sequences: 219361 Number of extensions: 1502454 Number of successful extensions: 2838 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2838 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)