| Clone Name | baal2o12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT3_CARPA (Q96386) Metallothionein-like protein type 3 (MT-3) | 60 | 5e-09 | 2 | MT3_MALDO (O24059) Metallothionein-like protein type 3 (MT-3) | 59 | 1e-08 | 3 | MT3_MUSAC (Q40256) Metallothionein-like protein type 3 (MT-3) (M... | 55 | 9e-08 | 4 | MT3_ACTCH (P43389) Metallothionein-like protein type 3 PKIWI503 | 52 | 1e-06 | 5 | MT3_PRUAV (O48951) Metallothionein-like protein 1 (MT-1) | 50 | 3e-06 | 6 | MT3_PICGL (Q40854) Metallothionein-like protein EMB30 | 42 | 0.001 |
|---|
>MT3_CARPA (Q96386) Metallothionein-like protein type 3 (MT-3)| Length = 65 Score = 59.7 bits (143), Expect = 5e-09 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 8 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKRCHTII 121 M+D CGNCDCADKTQCVKKG SY +++TEK T++ Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVV 38
>MT3_MALDO (O24059) Metallothionein-like protein type 3 (MT-3)| Length = 66 Score = 58.5 bits (140), Expect = 1e-08 Identities = 32/76 (42%), Positives = 41/76 (53%) Frame = +2 Query: 8 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKRCHTIISLR*SALLNYVP*YMTFYGGSR 187 M+ KC NCDCAD TQCVKKG+SY +V+V+TE R + +V + G Sbjct: 1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTV---------FVDAPAAEHDGKC 51 Query: 188 K**TDVGPCMYCTCSH 235 K T C+ CTC H Sbjct: 52 KCGTGCS-CVSCTCGH 66
>MT3_MUSAC (Q40256) Metallothionein-like protein type 3 (MT-3) (MWMT3)| Length = 65 Score = 55.5 bits (132), Expect = 9e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +2 Query: 20 CGNCDCADKTQCVKKGDSYGIVMVDTEK 103 CGNCDC DK+QCVKKG+SYGI +V+TEK Sbjct: 4 CGNCDCVDKSQCVKKGNSYGIDIVETEK 31
>MT3_ACTCH (P43389) Metallothionein-like protein type 3 PKIWI503| Length = 63 Score = 52.0 bits (123), Expect = 1e-06 Identities = 32/74 (43%), Positives = 38/74 (51%) Frame = +2 Query: 8 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKRCHTIISLR*SALLNYVP*YMTFYGGSR 187 M+DKCGNCDCAD +QCVKKG+S IV D ++ VP GG Sbjct: 1 MSDKCGNCDCADSSQCVKKGNSIDIVETDKSYIEDVVMG---------VP--AAESGGKC 49 Query: 188 K**TDVGPCMYCTC 229 K T PC+ CTC Sbjct: 50 KCGTSC-PCVNCTC 62
>MT3_PRUAV (O48951) Metallothionein-like protein 1 (MT-1)| Length = 64 Score = 50.4 bits (119), Expect = 3e-06 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +2 Query: 8 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKR 106 M+ KC NCDC+D +QC KKG S+ +V+V+TE R Sbjct: 1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENR 33
>MT3_PICGL (Q40854) Metallothionein-like protein EMB30| Length = 60 Score = 41.6 bits (96), Expect = 0.001 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 8 MADKCGNCDCADKTQCVKKG 67 M+ CGNCDCADK+QC KKG Sbjct: 1 MSSDCGNCDCADKSQCTKKG 20 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,329,430 Number of Sequences: 219361 Number of extensions: 937715 Number of successful extensions: 1969 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1969 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)