| Clone Name | baal3b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CF010_HUMAN (Q5SRN2) Protein C6orf10 | 34 | 0.36 | 2 | LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper moti... | 29 | 8.8 |
|---|
>CF010_HUMAN (Q5SRN2) Protein C6orf10| Length = 563 Score = 33.9 bits (76), Expect = 0.36 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 95 IDRGVATQVGPSIHRRPAGKSCAKDRSGLIIINGAKPRISAPRNGVTQRKRSSVTTS 265 + RG +QV S P G+ +SGL+++ G + ++ GV +R+ S V S Sbjct: 330 VPRGQESQVKKSESGVPKGQEAQVTKSGLVVLKGQEAQVEKSEMGVPRRQESQVKKS 386
>LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper motif-containing| protein) Length = 1051 Score = 29.3 bits (64), Expect = 8.8 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 9/40 (22%) Frame = -1 Query: 403 SLLVKPSSSLNRNT---------WKLQTVLSSVQAAATRH 311 S+L+KPS S+ RN+ WK + S V ++ TRH Sbjct: 879 SILIKPSDSVERNSHAFPAETIRWKSHSTSSEVASSDTRH 918 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,796,781 Number of Sequences: 219361 Number of extensions: 1946341 Number of successful extensions: 4882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4882 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)