ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal2m17 |
|---|---|
| Clone Library Name | barley_pub |
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 46.2 bits (108), Expect = 5e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG DGTKYWI+KNSWG W Sbjct: 294 VGYGATRDGTKYWIVKNSWGEEW 316
>CATB1_GIALA (P92131) Cathepsin B-like CP1 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B1) Length = 303 Score = 46.2 bits (108), Expect = 5e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT DGT YWI+KNSWG W Sbjct: 254 VGYGTTDDGTDYWIIKNSWGPDW 276
>CYSEP_VIGMU (P12412) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase) (Sulfhydryl-endopeptidase) (SH-EP) [Contains: Vignain-1; Vignain-2] Length = 362 Score = 45.8 bits (107), Expect = 6e-05 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXX-XLAQLASYPV 158 VGYGT DGT YWI++NSWG W +A +ASYP+ Sbjct: 293 VGYGTTVDGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCGIAMMASYPI 344
>CYSEP_RICCO (O65039) Vignain precursor (EC 3.4.22.-) (Cysteine endopeptidase)| Length = 360 Score = 45.8 bits (107), Expect = 6e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT DGTKYW +KNSWG W Sbjct: 291 VGYGTTIDGTKYWTVKNSWGPEW 313
>BROM1_ANACO (O23791) Bromelain precursor (EC 3.4.22.32) (Allergen Ana c 2)| Length = 351 Score = 45.4 bits (106), Expect = 8e-05 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +GYG S GTKYWI++NSWG SW Sbjct: 284 IGYGQDSSGTKYWIVRNSWGSSW 306
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 44.7 bits (104), Expect = 1e-04 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT DGT YWI++NSWG W Sbjct: 293 VGYGTTVDGTNYWIVRNSWGPEW 315
>CYSP1_HORVU (P25249) Cysteine proteinase EP-B 1 precursor (EC 3.4.22.-)| Length = 371 Score = 43.5 bits (101), Expect = 3e-04 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXX-XLAQLASYPV 158 VGYG A DG YW +KNSWG SW +A ASYPV Sbjct: 302 VGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPV 353
>CATB2_GIALA (P92132) Cathepsin B-like CP2 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B2) Length = 300 Score = 43.5 bits (101), Expect = 3e-04 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT DG YWI+KNSWG W Sbjct: 250 VGYGTDDDGVDYWIIKNSWGPDW 272
>CATB3_GIALA (P92133) Cathepsin B-like CP3 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B3) Length = 299 Score = 43.5 bits (101), Expect = 3e-04 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT DG YWI+KNSWG W Sbjct: 249 VGYGTDDDGVDYWIIKNSWGPDW 271
>CYSP2_HORVU (P25250) Cysteine proteinase EP-B 2 precursor (EC 3.4.22.-)| Length = 373 Score = 43.5 bits (101), Expect = 3e-04 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXX-XLAQLASYPV 158 VGYG A DG YW +KNSWG SW +A ASYPV Sbjct: 302 VGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPV 353
>CRUST_PANBO (Q86GF7) Crustapain precursor (EC 3.4.22.-) (NsCys)| Length = 323 Score = 42.4 bits (98), Expect = 7e-04 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT ++G YWI+KNSWG W Sbjct: 273 AVGYGTDANGGDYWIVKNSWGAWW 296
>ACP1_ENTHI (P36184) Cysteine proteinase ACP1 precursor (EC 3.4.22.-)| Length = 308 Score = 41.2 bits (95), Expect = 0.002 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ S+G KYWI++NSWG SW Sbjct: 255 AVGYGSNSNG-KYWIIRNSWGTSW 277
>CATK_RAT (O35186) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT G KYWI+KNSWG SW Sbjct: 281 VGYGTQK-GNKYWIIKNSWGESW 302
>CATL_SARPE (Q26636) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 339 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT G YW++KNSWG +W Sbjct: 290 VGYGTDESGMDYWLVKNSWGTTW 312
>CATK_CHICK (Q90686) Cathepsin K precursor (EC 3.4.22.38) (JTAP-1)| Length = 334 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG A GTK+WI+KNSWG W Sbjct: 285 AVGYG-AQKGTKHWIIKNSWGTEW 307
>CPR2_ARATH (Q9LXW3) Probable cysteine proteinase At3g43960 precursor (EC| 3.4.22.-) Length = 376 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT+SD YW+++NSWG W Sbjct: 295 VGYGTSSDEGDYWLIRNSWGPEW 317
>ANAN_ANACO (P80884) Ananain precursor (EC 3.4.22.31)| Length = 345 Score = 40.0 bits (92), Expect = 0.003 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +GYG S G K+WI++NSWG W Sbjct: 284 IGYGQDSSGKKFWIVRNSWGAGW 306
>CATLL_FASHE (Q24940) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 326 Score = 39.7 bits (91), Expect = 0.004 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT GT YWI+KNSWG W Sbjct: 273 AVGYGTQG-GTDYWIVKNSWGTYW 295
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT +G YWI++NSWG SW Sbjct: 293 AVGYGT-ENGKDYWIVRNSWGKSW 315
>CYSP3_LYCES (Q40143) Cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 356 Score = 39.3 bits (90), Expect = 0.006 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +GT YW++KNSWG W Sbjct: 307 AVGYGV-ENGTPYWLIKNSWGADW 329
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 39.3 bits (90), Expect = 0.006 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 3 AVGYGT-ASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXX-XLAQLASYPV 158 AVGYGT A+ G YW ++NSWG W +A +ASYP+ Sbjct: 321 AVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMASYPI 374
>ERVB_TABDI (P60994) Ervatamin-B (EC 3.4.22.-) (ERV-B)| Length = 215 Score = 39.3 bits (90), Expect = 0.006 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSWXXXXXX-XXXXXXXXXXXXXLAQLASYP 155 VGYGT S G YWI++NSWG +W +AQL SYP Sbjct: 163 VGYGTQS-GKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYP 212
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT +G YWI++NSWG SW Sbjct: 301 AVGYGT-ENGKDYWIVRNSWGKSW 323
>ALEU_ARATH (Q8H166) Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU)| (Senescence-associated gene product 2) Length = 358 Score = 39.3 bits (90), Expect = 0.006 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG YW++KNSWG W Sbjct: 309 AVGYGV-EDGVPYWLIKNSWGADW 331
>CATC_MACFA (Q60HG6) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 39.3 bits (90), Expect = 0.006 Identities = 17/24 (70%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYGT S G YWI+KNSWG SW Sbjct: 410 VGYGTDSASGMDYWIVKNSWGTSW 433
>CATL_HUMAN (P07711) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 333 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG T SD KYW++KNSWG W Sbjct: 281 VGYGFESTESDNNKYWLVKNSWGEEW 306
>CATK_MOUSE (P55097) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT G+K+WI+KNSWG SW Sbjct: 281 VGYGTQK-GSKHWIIKNSWGESW 302
>CYSP2_MAIZE (Q10717) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 360 Score = 39.3 bits (90), Expect = 0.006 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG YW++KNSWG W Sbjct: 311 AVGYGV-EDGVPYWLIKNSWGADW 333
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 38.9 bits (89), Expect = 0.007 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VG+GT G YW++KNSWG +W Sbjct: 292 VGFGTDESGEDYWLVKNSWGTTW 314
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 38.9 bits (89), Expect = 0.007 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG D YW++KNSWGG W Sbjct: 309 AVGYGVEDD-VPYWLIKNSWGGEW 331
>CATZ_RAT (Q9R1T3) Cathepsin Z precursor (EC 3.4.22.-) (Cathepsin Y)| Length = 306 Score = 38.5 bits (88), Expect = 0.010 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 9 GYGTASDGTKYWIMKNSWGGSW 74 G+G ++DG +YWI++NSWG W Sbjct: 249 GWGVSNDGIEYWIVRNSWGEPW 270
>CATZ_MOUSE (Q9WUU7) Cathepsin Z precursor (EC 3.4.22.-)| Length = 306 Score = 38.5 bits (88), Expect = 0.010 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 9 GYGTASDGTKYWIMKNSWGGSW 74 G+G ++DG +YWI++NSWG W Sbjct: 249 GWGVSNDGIEYWIVRNSWGEPW 270
>CYSP3_HOMAM (P25784) Digestive cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 321 Score = 38.5 bits (88), Expect = 0.010 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT S YW++KNSWG SW Sbjct: 272 AVGYGTEST-KDYWLVKNSWGSSW 294
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 38.5 bits (88), Expect = 0.010 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXX-XLAQLASYP 155 AVGYGT +G YWI++NSWG W +A +ASYP Sbjct: 305 AVGYGT-DNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYP 355
>P34_SOYBN (P22895) P34 probable thiol protease precursor (EC 3.4.22.-)| Length = 379 Score = 38.5 bits (88), Expect = 0.010 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG+A DG YWI KNSWG W Sbjct: 306 VGYGSA-DGVDYWIAKNSWGFDW 327
>CATL_BRUPA (O17473) Cathepsin L-like precursor (EC 3.4.22.15)| Length = 395 Score = 38.1 bits (87), Expect = 0.013 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT YWI+KNSWG W Sbjct: 346 AVGYGTHPSYGDYWIVKNSWGTDW 369
>CATK_RABIT (P43236) Cathepsin K precursor (EC 3.4.22.38) (OC-2 protein)| Length = 329 Score = 38.1 bits (87), Expect = 0.013 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG G K+WI+KNSWG SW Sbjct: 280 AVGYGIQK-GNKHWIIKNSWGESW 302
>ACTN_ACTCH (P00785) Actinidain precursor (EC 3.4.22.14) (Actinidin) (Allergen| Act c 1) Length = 380 Score = 38.1 bits (87), Expect = 0.013 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXXXLAQLASYPV 158 VGYGT G YWI+KNSW +W +A + SYPV Sbjct: 293 VGYGTEG-GIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPV 342
>CATC_CANFA (O97578) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 435 Score = 38.1 bits (87), Expect = 0.013 Identities = 16/24 (66%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYGT S G YWI+KNSWG W Sbjct: 382 VGYGTDSASGMDYWIVKNSWGSRW 405
>PAPA2_CARPA (P14080) Chymopapain precursor (EC 3.4.22.6) (Papaya proteinase II)| (PPII) Length = 352 Score = 37.7 bits (86), Expect = 0.017 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYGT SDG Y I+KNSWG +W Sbjct: 297 AVGYGT-SDGKNYIIIKNSWGPNW 319
>CATC_HUMAN (P53634) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 37.7 bits (86), Expect = 0.017 Identities = 16/24 (66%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYGT S G YWI+KNSWG W Sbjct: 410 VGYGTDSASGMDYWIVKNSWGTGW 433
>CATV_NPVST (Q91BH1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 37.7 bits (86), Expect = 0.017 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +D T YWI KNSWG +W Sbjct: 288 VGYGIEND-TPYWIFKNSWGSNW 309
>CATL_MOUSE (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (p39 cysteine proteinase) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 37.7 bits (86), Expect = 0.017 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXXXLAQLASYPV 158 VGYG T S+ KYW++KNSWG W LA ASYPV Sbjct: 281 VGYGYEGTDSNKNKYWLVKNSWGSEW--GMEGYIKIAKDRDNHCGLATAASYPV 332
>CATJ_MOUSE (Q9R014) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 37.7 bits (86), Expect = 0.017 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 6 VGYGT---ASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXXXLAQLASYP 155 VGYG+ DG YW++KNSWG W +A LASYP Sbjct: 281 VGYGSEGDVKDGNNYWLIKNSWGEEW--GMNGYMQIAKDHNNHCGIASLASYP 331
>ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-)| Length = 362 Score = 37.4 bits (85), Expect = 0.022 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YW++KNSWG W Sbjct: 313 AVGYGV-ENGVPYWLIKNSWGADW 335
>ALEU_HORVU (P05167) Thiol protease aleurain precursor (EC 3.4.22.16)| Length = 362 Score = 37.4 bits (85), Expect = 0.022 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YW++KNSWG W Sbjct: 312 AVGYGV-ENGVPYWLIKNSWGADW 334
>CATH_RAT (P00786) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 37.4 bits (85), Expect = 0.022 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YWI+KNSWG +W Sbjct: 283 AVGYGE-QNGLLYWIVKNSWGSNW 305
>CATK_MACMU (P61277) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 37.0 bits (84), Expect = 0.028 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG G K+WI+KNSWG +W Sbjct: 280 AVGYGIQK-GNKHWIIKNSWGENW 302
>CATK_MACFA (P61276) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 37.0 bits (84), Expect = 0.028 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG G K+WI+KNSWG +W Sbjct: 280 AVGYGIQK-GNKHWIIKNSWGENW 302
>CATK_HUMAN (P43235) Cathepsin K precursor (EC 3.4.22.38) (Cathepsin O)| (Cathepsin X) (Cathepsin O2) Length = 329 Score = 37.0 bits (84), Expect = 0.028 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG G K+WI+KNSWG +W Sbjct: 280 AVGYGIQK-GNKHWIIKNSWGENW 302
>CATL_FELCA (P25773) Cathepsin L (EC 3.4.22.15) (Progesterone-dependent| protein) (PDP) (Fragment) Length = 139 Score = 37.0 bits (84), Expect = 0.028 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG T ++ KYWI+KNSWG W Sbjct: 102 VGYGADGTETENKKYWIIKNSWGTDW 127
>CATL_SHEEP (Q10991) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] Length = 217 Score = 37.0 bits (84), Expect = 0.028 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG K+WI+KNSWG W Sbjct: 168 VGYGFEGTNNKFWIVKNSWGPEW 190
>CATH_MOUSE (P49935) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 37.0 bits (84), Expect = 0.028 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YWI+KNSWG W Sbjct: 283 AVGYGE-QNGLLYWIVKNSWGSQW 305
>CATLL_PHACE (O97397) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 324 Score = 37.0 bits (84), Expect = 0.028 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +G KYWI+KN+WG W Sbjct: 275 VGYGI-ENGQKYWIIKNTWGADW 296
>CATV_NPVAH (Q80LP4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT G YW +KNSWG W Sbjct: 288 VGYGTEG-GVSYWTLKNSWGSDW 309
>CATZ_HUMAN (Q9UBR2) Cathepsin Z precursor (EC 3.4.22.-) (Cathepsin X)| (Cathepsin P) Length = 303 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 9 GYGTASDGTKYWIMKNSWGGSW 74 G+G SDGT+YWI++NSWG W Sbjct: 247 GWGI-SDGTEYWIVRNSWGEPW 267
>ACP2_ENTHI (P36185) Cysteine proteinase ACP2 precursor (EC 3.4.22.-)| (Fragment) Length = 310 Score = 36.6 bits (83), Expect = 0.037 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG + WI++NSWG SW Sbjct: 258 AVGYGVV-DGKECWIVRNSWGTSW 280
>CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 346 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +D KYW +KNSWG W Sbjct: 294 VGYGQEND-VKYWTLKNSWGSDW 315
>CATH_PIG (O46427) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 36.6 bits (83), Expect = 0.037 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YWI+KNSWG W Sbjct: 285 AVGYGE-ENGIPYWIVKNSWGPQW 307
>CATH_HUMAN (P09668) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 36.6 bits (83), Expect = 0.037 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG +G YWI+KNSWG W Sbjct: 285 AVGYGE-KNGIPYWIVKNSWGPQW 307
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +D YWI+KNSWG W Sbjct: 285 VGYGVKND-VPYWILKNSWGAEW 306
>CATK_PIG (Q9GLE3) Cathepsin K precursor (EC 3.4.22.38)| Length = 330 Score = 36.6 bits (83), Expect = 0.037 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG G K+WI+KNSWG +W Sbjct: 281 AVGYGIQK-GKKHWIIKNSWGENW 303
>CATL_PIG (Q28944) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 36.6 bits (83), Expect = 0.037 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG T S+ +K+WI+KNSWG W Sbjct: 282 VGYGFEGTDSNSSKFWIVKNSWGPEW 307
>CATJ_RAT (Q63088) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 36.6 bits (83), Expect = 0.037 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG +DG YW++KNSWG W Sbjct: 281 VGYGFEGNETDGNNYWLIKNSWGEEW 306
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 36.2 bits (82), Expect = 0.048 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ +G YWI++NSWG W Sbjct: 264 AVGYGS-ENGVDYWIVRNSWGTRW 286
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 36.2 bits (82), Expect = 0.048 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ +G YWI++NSWG W Sbjct: 309 AVGYGS-ENGVDYWIVRNSWGPRW 331
>CATQ_RAT (Q9QZE3) Cathepsin Q precursor (EC 3.4.22.-)| Length = 343 Score = 36.2 bits (82), Expect = 0.048 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG +DG YW++KNSWG W Sbjct: 291 VGYGFEGNETDGNNYWLIKNSWGKRW 316
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 36.2 bits (82), Expect = 0.048 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSWXXXXXXXXXXXXXXXXXXXLAQLASYPV 158 VGYG T S+ KYW++KNSWG W LA ASYP+ Sbjct: 281 VGYGYEGTDSNKDKYWLVKNSWGKEW--GMDGYIKIAKDRNNHCGLATAASYPI 332
>CATL_BOVIN (P25975) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 36.2 bits (82), Expect = 0.048 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG T S+ K+WI+KNSWG W Sbjct: 282 VGYGFEGTDSNNNKFWIVKNSWGPEW 307
>CATL_CHICK (P09648) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] (Fragments) Length = 218 Score = 36.2 bits (82), Expect = 0.048 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG G KYWI+KNSWG W Sbjct: 170 VGYGFEG-GKKYWIVKNSWGEKW 191
>TEST2_RAT (P15242) Testin 2 precursor (CMB-23) [Contains: Testin 1 (CMB-22)]| Length = 333 Score = 35.8 bits (81), Expect = 0.063 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG SDG +W++KNSWG W Sbjct: 281 VGYGFEGEESDGNSFWLVKNSWGEEW 306
>CPGP2_ZINOF (P82474) Cysteine proteinase GP-II (EC 3.4.22.-)| Length = 221 Score = 35.8 bits (81), Expect = 0.063 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT +D +WI+KNSWG +W Sbjct: 166 VGYGTEND-KDFWIVKNSWGKNW 187
>CATL_SCHMA (Q26534) Cathepsin L precursor (EC 3.4.22.15) (SMCL1)| Length = 319 Score = 35.4 bits (80), Expect = 0.082 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG + +WI+KNSWG W Sbjct: 270 VGYGVSEKNEPFWIVKNSWGVEW 292
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 35.4 bits (80), Expect = 0.082 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG+ S G YWI++NSWG +W Sbjct: 298 VGYGSTS-GEDYWIIRNSWGLNW 319
>CATR_MOUSE (Q9JIA9) Cathepsin R precursor (EC 3.4.22.-)| Length = 334 Score = 35.4 bits (80), Expect = 0.082 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG +DG YW++KNSWG W Sbjct: 282 VGYGFKGIETDGNHYWLIKNSWGKRW 307
>CATL2_HUMAN (O60911) Cathepsin L2 precursor (EC 3.4.22.43) (Cathepsin V)| (Cathepsin U) Length = 334 Score = 35.4 bits (80), Expect = 0.082 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYG---TASDGTKYWIMKNSWGGSW 74 VGYG S+ +KYW++KNSWG W Sbjct: 282 VGYGFEGANSNNSKYWLVKNSWGPEW 307
>CPP3_ENTHI (Q06964) Cysteine proteinase 3 precursor (EC 3.4.22.-) (Cysteine| proteinase ACP3) (Fragment) Length = 308 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG + WI++NSWG W Sbjct: 256 AVGYGVV-DGKECWIVRNSWGTGW 278
>CPP2_ENTHI (Q01958) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 315 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG + WI++NSWG W Sbjct: 263 AVGYGVV-DGKECWIVRNSWGTGW 285
>CPP1_ENTHI (Q01957) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 315 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG DG + WI++NSWG W Sbjct: 263 AVGYGVV-DGKECWIVRNSWGTGW 285
>CATC_MOUSE (P97821) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 462 Score = 35.0 bits (79), Expect = 0.11 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYG G +YWI+KNSWG +W Sbjct: 409 VGYGRDPVTGIEYWIIKNSWGSNW 432
>CYSP5_DICDI (P54640) Cysteine proteinase 5 precursor (EC 3.4.22.-)| Length = 344 Score = 34.7 bits (78), Expect = 0.14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 18 TASDGTKYWIMKNSWGGSW 74 +AS +YWI+KNSWG SW Sbjct: 299 SASSSNEYWIVKNSWGTSW 317
>CATZ_BOVIN (P05689) Cathepsin Z (EC 3.4.22.-) (Fragment)| Length = 73 Score = 34.7 bits (78), Expect = 0.14 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +3 Query: 9 GYGTASDGTKYWIMKNSWGGSW 74 G+G SDG +YWI++NSWG W Sbjct: 17 GWGV-SDGMEYWIVRNSWGEPW 37
>CATS_MOUSE (O70370) Cathepsin S precursor (EC 3.4.22.27)| Length = 340 Score = 34.7 bits (78), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWG 65 VGYGT DG YW++KNSWG Sbjct: 292 VGYGTL-DGKDYWLVKNSWG 310
>CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 34.7 bits (78), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWG 65 VGYGT DG YW++KNSWG Sbjct: 282 VGYGTL-DGKDYWLVKNSWG 300
>CATV_NPVLD (Q9YMP9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 356 Score = 34.3 bits (77), Expect = 0.18 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +G YW+ KN+WG W Sbjct: 307 VGYGV-ENGVPYWVFKNTWGDDW 328
>CATM_MOUSE (Q9JL96) Cathepsin M precursor (EC 3.4.22.-)| Length = 333 Score = 34.3 bits (77), Expect = 0.18 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 6 VGYGTA---SDGTKYWIMKNSWGGSW 74 VGYG SDG KYW++KNS G W Sbjct: 281 VGYGFTGRESDGRKYWLVKNSMGTQW 306
>CATV_NPVAP (Q91CL9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.9 bits (76), Expect = 0.24 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG +G +WI+KN+WG W Sbjct: 275 VGYGV-ENGIPFWILKNTWGADW 296
>CATC_RAT (P80067) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion domai Length = 462 Score = 33.9 bits (76), Expect = 0.24 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYG G YWI+KNSWG W Sbjct: 409 VGYGKDPVTGLDYWIVKNSWGSQW 432
>CATV_NPVEP (Q91GE3) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 33.9 bits (76), Expect = 0.24 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YWI+KNSWG W Sbjct: 274 VGYGVENN-VPYWILKNSWGTDW 295
>XCP2_ARATH (Q9LM66) Xylem cysteine proteinase 2 precursor (EC 3.4.22.-)| (AtXCP2) Length = 356 Score = 33.5 bits (75), Expect = 0.31 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ S G+ Y I+KNSWG W Sbjct: 302 AVGYGS-SKGSDYIIVKNSWGPKW 324
>CPR1_CAEEL (P25807) Gut-specific cysteine proteinase precursor (EC 3.4.22.-)| Length = 329 Score = 33.5 bits (75), Expect = 0.31 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+GT S G+ YW++ NSWG +W Sbjct: 280 IGWGTES-GSPYWLVANSWGVNW 301
>LMCPB_LEIME (P36400) Cysteine proteinase B precursor (EC 3.4.22.-)| Length = 443 Score = 33.5 bits (75), Expect = 0.31 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY + YW++KNSWGG W Sbjct: 293 VGYDMTGE-VPYWVIKNSWGGDW 314
>CYSP2_LEIPI (Q05094) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-2) Length = 444 Score = 33.5 bits (75), Expect = 0.31 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY + YW++KNSWGG W Sbjct: 294 VGYDMTGE-VPYWVIKNSWGGDW 315
>MDO1_PSEMR (P83443) Macrodontain-1 (EC 3.4.22.-) (Macrodontain I)| Length = 213 Score = 33.5 bits (75), Expect = 0.31 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +GYG S YWI++NSWG SW Sbjct: 164 IGYGRDS----YWIVRNSWGSSW 182
>CYSP1_HOMAM (P13277) Digestive cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 322 Score = 33.5 bits (75), Expect = 0.31 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ G +W++KNSW SW Sbjct: 273 AVGYGSEG-GQDFWLVKNSWATSW 295
>CYSP2_HOMAM (P25782) Digestive cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 323 Score = 33.5 bits (75), Expect = 0.31 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ G +W++KNSW SW Sbjct: 274 AVGYGSEG-GQDFWLVKNSWATSW 296
>CYSP7_DICDI (Q94504) Cysteine proteinase 7 precursor (EC 3.4.22.-) (Proteinase| 1) Length = 460 Score = 33.1 bits (74), Expect = 0.41 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +3 Query: 12 YGTASDGTKYWIMKNSWGGSW 74 Y TA D YWI+KNSWG SW Sbjct: 412 YPTAGD---YWIVKNSWGTSW 429
>CATF_MOUSE (Q9R013) Cathepsin F precursor (EC 3.4.22.41)| Length = 462 Score = 33.1 bits (74), Expect = 0.41 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG S+ YW +KNSWG W Sbjct: 414 VGYGNRSN-IPYWAIKNSWGSDW 435
>A494_ARATH (P43295) Probable cysteine proteinase A494 precursor (EC 3.4.22.-)| Length = 361 Score = 33.1 bits (74), Expect = 0.41 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = +3 Query: 6 VGYGTASDGTK------YWIMKNSWGGSW 74 VGYG+A YWI+KNSWG SW Sbjct: 304 VGYGSAGFSQARLKEKPYWIIKNSWGESW 332
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 33.1 bits (74), Expect = 0.41 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG SD +W +KNSWG W Sbjct: 436 VGYGNRSD-VPFWAIKNSWGTDW 457
>XCP1_ARATH (O65493) Xylem cysteine proteinase 1 precursor (EC 3.4.22.-)| (AtXCP1) Length = 355 Score = 33.1 bits (74), Expect = 0.41 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG+ S G+ Y I+KNSWG W Sbjct: 301 AVGYGS-SKGSDYVIVKNSWGPRW 323
>CPR4_ARATH (Q9SUS9) Probable cysteine proteinase At4g11320 precursor (EC| 3.4.22.-) Length = 371 Score = 32.7 bits (73), Expect = 0.53 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT +G YWI+KNS G +W Sbjct: 309 VGYGT-ENGRDYWIVKNSRGDTW 330
>CATV_NPVHC (Q9WGE0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 32.7 bits (73), Expect = 0.53 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YWI+KN+WG W Sbjct: 275 VGYGVENN-VPYWILKNTWGEDW 296
>CATS_BOVIN (P25326) Cathepsin S (EC 3.4.22.27)| Length = 217 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWG 65 VGYG DG YW++KNSWG Sbjct: 169 VGYGNL-DGKDYWLVKNSWG 187
>CATL_CANFA (Q9GL24) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 333 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 6 VGYGT--ASDGTKYWIMKNSWGGSW 74 VGYG K+WI+KNSWG W Sbjct: 282 VGYGFEGTDSNNKFWIVKNSWGPEW 306
>EURM1_EURMA (P25780) Mite group 1 allergen Eur m 1 precursor (EC 3.4.22.-) (Eur| m I) Length = 321 Score = 32.3 bits (72), Expect = 0.70 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG + G YWI++NSW +W Sbjct: 274 VGYGN-TQGVDYWIVRNSWDTTW 295
>DERF1_DERFA (P16311) Major mite fecal allergen Der f 1 precursor (EC 3.4.22.-)| (Der f I) Length = 321 Score = 32.3 bits (72), Expect = 0.70 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG+ + G YWI++NSW +W Sbjct: 274 VGYGS-TQGDDYWIVRNSWDTTW 295
>CYSP_THEAN (P25781) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 441 Score = 32.3 bits (72), Expect = 0.70 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTASD-GTKYWIMKNSWGGSW 74 VG G + G +YWI+KNSWG W Sbjct: 386 VGEGVDHETGMRYWIIKNSWGEDW 409
>CATO_HUMAN (P43234) Cathepsin O precursor (EC 3.4.22.42)| Length = 321 Score = 32.0 bits (71), Expect = 0.91 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 Query: 33 TKYWIMKNSWGGSW 74 T YWI++NSWG SW Sbjct: 282 TPYWIVRNSWGSSW 295
>RD19A_ARATH (P43296) Cysteine proteinase RD19a precursor (EC 3.4.22.-) (RD19)| Length = 368 Score = 32.0 bits (71), Expect = 0.91 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 3 AVGYGTASDGTK-YWIMKNSWGGSW 74 A GY A K YWI+KNSWG +W Sbjct: 311 AAGYAPARFKEKPYWIIKNSWGETW 335
>CATV_NPVCF (P41715) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 32.0 bits (71), Expect = 0.91 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY +G +WI+KN+WG W Sbjct: 275 VGYAV-ENGVPFWILKNTWGADW 296
>CATV_NPVCD (O41479) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 32.0 bits (71), Expect = 0.91 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY +G +WI+KN+WG W Sbjct: 275 VGYAV-ENGVPFWILKNTWGADW 296
>CATW_HUMAN (P56202) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 376 Score = 32.0 bits (71), Expect = 0.91 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 33 TKYWIMKNSWGGSW 74 T YWI+KNSWG W Sbjct: 324 TPYWILKNSWGAQW 337
>SERA_PLAFG (P69192) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 989 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = +3 Query: 6 VGYGTA--SDGTK--YWIMKNSWGGSW 74 VGYG S+G K YWI++NSWG W Sbjct: 759 VGYGNYVNSEGEKKSYWIVRNSWGPYW 785
>SERA_PLAFD (P69193) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 989 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = +3 Query: 6 VGYGTA--SDGTK--YWIMKNSWGGSW 74 VGYG S+G K YWI++NSWG W Sbjct: 759 VGYGNYVNSEGEKKSYWIVRNSWGPYW 785
>PAPA5_CARPA (P05993) Cysteine proteinase (EC 3.4.22.-) (Clone PLBPC13)| (Fragment) Length = 96 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = +3 Query: 6 VGYGTASDGT------KYWIMKNSWGGSW 74 VGYG+A YW++KNSWG +W Sbjct: 36 VGYGSAGYAPIRLKEKPYWVIKNSWGENW 64
>SERA_PLAF7 (Q9TY95) Serine-repeat antigen protein precursor (p126) (111 kDa| antigen) Length = 997 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = +3 Query: 6 VGYGTA--SDGTK--YWIMKNSWGGSW 74 VGYG S+G K YWI++NSWG W Sbjct: 767 VGYGNYVNSEGEKKSYWIVRNSWGPYW 793
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 9 GYGTASDGTKYWIMKNSWGGS 71 GYGT +G YWI++NSWG + Sbjct: 184 GYGT-ENGMDYWIVRNSWGAN 203
>CATS_SAIBB (Q8HY82) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 31.6 bits (70), Expect = 1.2 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +GYG + G +YW++KNSWG ++ Sbjct: 282 IGYGDLN-GKEYWLVKNSWGSNF 303
>LMCPA_LEIME (P25775) Cysteine proteinase A precursor (EC 3.4.22.-)| Length = 354 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG SW Sbjct: 304 YWIVKNSWGSSW 315
>CYSP4_DICDI (P54639) Cysteine proteinase 4 precursor (EC 3.4.22.-)| Length = 442 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 21 ASDGTKYWIMKNSWGGSW 74 AS G YWI+KNSWG SW Sbjct: 396 ASSGN-YWIVKNSWGTSW 412
>CYSP1_LEIPI (P35591) Cysteine proteinase 1 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-1) Length = 354 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG SW Sbjct: 304 YWIVKNSWGSSW 315
>CPR4_CAEEL (P43508) Cathepsin B-like cysteine proteinase 4 precursor (EC| 3.4.22.-) (Cysteine protease-related 4) Length = 335 Score = 31.2 bits (69), Expect = 1.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+GT +GT YW++ NSW +W Sbjct: 286 LGWGT-DNGTPYWLVANSWNVNW 307
>PAPA3_CARPA (P10056) Caricain precursor (EC 3.4.22.30) (Papaya proteinase| omega) (Papaya proteinase III) (PPIII) (Papaya peptidase A) Length = 348 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG S G Y ++KNSWG +W Sbjct: 295 AVGYGK-SGGKGYILIKNSWGTAW 317
>DERP1_DERPT (P08176) Major mite fecal allergen Der p 1 precursor (EC 3.4.22.-)| (Der p I) Length = 320 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY A G YWI++NSW +W Sbjct: 273 VGYSNAQ-GVDYWIVRNSWDTNW 294
>CATS_HUMAN (P25774) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWG 65 VGYG + G +YW++KNSWG Sbjct: 283 VGYGDLN-GKEYWLVKNSWG 301
>CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-)| Length = 454 Score = 31.2 bits (69), Expect = 1.6 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 6 VGYGTAS-DGTKYWIMKNSWGGSW 74 VGYG G YW +KNSWG W Sbjct: 403 VGYGVDKLSGEPYWKVKNSWGVEW 426
>CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 367 Score = 30.8 bits (68), Expect = 2.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+G ++ YWI+KNSWG W Sbjct: 318 IGWGIENN-VPYWIIKNSWGEDW 339
>CATO_MOUSE (Q8BM88) Cathepsin O precursor (EC 3.4.22.42)| Length = 312 Score = 30.8 bits (68), Expect = 2.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 33 TKYWIMKNSWGGSW 74 T YW+++NSWG SW Sbjct: 273 TPYWMVRNSWGSSW 286
>CATV_NPVSE (Q9J8B9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YWI+KNSWG + Sbjct: 288 VGYGVENN-VPYWIIKNSWGSDY 309
>CYSP1_MAIZE (Q10716) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 371 Score = 30.8 bits (68), Expect = 2.0 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 6/29 (20%) Frame = +3 Query: 6 VGYGTAS------DGTKYWIMKNSWGGSW 74 VGYG + YWI+KNSWG +W Sbjct: 308 VGYGASGFAPIRLKDKPYWIIKNSWGENW 336
>CYSP2_DICDI (P04989) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Prestalk| cathepsin) Length = 376 Score = 30.8 bits (68), Expect = 2.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG SW Sbjct: 338 YWIVKNSWGTSW 349
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 30.8 bits (68), Expect = 2.0 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYGT +G YW++KNS G +W Sbjct: 302 VGYGT-ENGRDYWLVKNSRGITW 323
>CATS_CANFA (Q8HY81) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWG 65 VGYG + G YW++KNSWG Sbjct: 283 VGYGNLN-GKDYWLVKNSWG 301
>PAPA4_CARPA (P05994) Papaya proteinase 4 precursor (EC 3.4.22.25) (Papaya| proteinase IV) (PPIV) (Papaya peptidase B) (Glycyl endopeptidase) Length = 348 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 3 AVGYGTASDGTKYWIMKNSWGGSW 74 AVGYG S G Y ++KNSWG W Sbjct: 295 AVGYGK-SGGKGYILIKNSWGPGW 317
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = +3 Query: 6 VGYGTAS-----DGTKYWIMKNSWGGSW 74 VGYG + YWI+KNSWG W Sbjct: 560 VGYGVSDYPNFHKTLPYWIVKNSWGPRW 587
>CATV_NPVOP (O10364) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY ++ YWI+KN+WG W Sbjct: 275 VGYAVENN-IPYWILKNTWGTDW 296
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 30.0 bits (66), Expect = 3.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG W Sbjct: 306 YWIVKNSWGADW 317
>CATW_MOUSE (P56203) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 371 Score = 30.0 bits (66), Expect = 3.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG W Sbjct: 321 YWILKNSWGAHW 332
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 29.6 bits (65), Expect = 4.5 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +3 Query: 39 YWIMKNSWGGSW 74 YWI+KNSWG +W Sbjct: 321 YWIIKNSWGQNW 332
>CATV_NPVRO (Q8B9D5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YW KN+WG W Sbjct: 274 VGYGVENN-IPYWTFKNTWGTDW 295
>CATV_NPVBM (P41721) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YW KN+WG W Sbjct: 274 VGYGVENN-IPYWTFKNTWGTDW 295
>CATV_NPVAC (P25783) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 29.6 bits (65), Expect = 4.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGYG ++ YW KN+WG W Sbjct: 274 VGYGVENN-IPYWTFKNTWGTDW 295
>CPR5_CAEEL (P43509) Cathepsin B-like cysteine proteinase 5 precursor (EC| 3.4.22.-) (Cysteine protease-related 5) Length = 344 Score = 29.3 bits (64), Expect = 5.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+G +GT YW++ NSW +W Sbjct: 291 LGWGV-DNGTPYWLVANSWNVAW 312
>CYSP_TRYBB (P14658) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 450 Score = 29.3 bits (64), Expect = 5.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 VGY S+ YWI+KNSW W Sbjct: 292 VGYNDNSN-PPYWIIKNSWSNMW 313
>CATC_PLAF7 (Q8IIJ9) Probable cathepsin C precursor (EC 3.4.22.-)| Length = 700 Score = 29.3 bits (64), Expect = 5.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 36 KYWIMKNSWGGSW 74 KYWI +NSWG W Sbjct: 642 KYWIGRNSWGNGW 654
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 29.3 bits (64), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+G GT YWI+ NSW W Sbjct: 293 IGWGEEK-GTPYWIVANSWHDDW 314
>CATB_HUMAN (P07858) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (APP| secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 29.3 bits (64), Expect = 5.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+G +GT YW++ NSW W Sbjct: 283 LGWGV-ENGTPYWLVANSWNTDW 304
>CATB_BOVIN (P07688) Cathepsin B precursor (EC 3.4.22.1) [Contains: Cathepsin B| light chain; Cathepsin B heavy chain] Length = 335 Score = 28.9 bits (63), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 6 VGYGTASDGTKYWIMKNSWGGSW 74 +G+G +GT YW++ NSW W Sbjct: 283 LGWGV-ENGTPYWLVGNSWNTDW 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,762,189 Number of Sequences: 219361 Number of extensions: 850526 Number of successful extensions: 1738 Number of sequences better than 10.0: 149 Number of HSP's better than 10.0 without gapping: 1715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1738 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
