| Clone Name | baal2g24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein p... | 32 | 1.2 | 2 | GUN1_TRILO (Q12714) Endoglucanase EG-1 precursor (EC 3.2.1.4) (E... | 31 | 2.0 | 3 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 30 | 2.7 | 4 | ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin rece... | 30 | 3.5 | 5 | SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein | 29 | 5.9 |
|---|
>DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein precursor| Length = 1204 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +3 Query: 48 YILQRRSAWYEPRGEAIASPRGSYFSAAALGTRTSARGIFSTPSYP 185 Y W+ P ASP S+ G TSA G FS+PSYP Sbjct: 494 YTTTPSQTWWHPTTTTAASP-----SSPCGGFLTSASGTFSSPSYP 534
>GUN1_TRILO (Q12714) Endoglucanase EG-1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) Length = 463 Score = 30.8 bits (68), Expect = 2.0 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = -3 Query: 426 DVGLSNENIGENPMPRKPKVSSARFVHGG*VRA*DQAERRSRWTTGQYSCTTPCW 262 D+G + + G NP P P SS F RRS T+ SCT W Sbjct: 388 DIGSTTNSTGGNPPPPPPPASSTTF----------STTRRSSTTSSSPSCTQTHW 432
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 392 IQCPENPRFPPQGSSTEGESGPK 324 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 15 RSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYFSAAALGTRTSARGIFSTPSYPE 188 RS FSW G GY SA + G + GSYF + + T + + YPE Sbjct: 193 RSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ--IAESYYPE 248
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 178 EGVEKMPRAEVRVPSAAALKYEPRGLAIASPR 83 EG++ PRA+ P AA L P +ASPR Sbjct: 417 EGLQSPPRAQSAPPEAAVLPPSPLPAPVASPR 448 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,456,196 Number of Sequences: 219361 Number of extensions: 1714635 Number of successful extensions: 4591 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4587 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)