| Clone Name | baal2d16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTW3C_KLEPN (P45604) PTS system N-acetylglucosamine-specific EII... | 30 | 1.7 | 2 | PTW3C_ECOLI (P09323) PTS system N-acetylglucosamine-specific EII... | 30 | 2.2 | 3 | R3HD1_HUMAN (Q15032) R3H domain-containing protein 1 | 28 | 5.0 | 4 | DNJB2_HUMAN (P25686) DnaJ homolog subfamily B member 2 (Heat sho... | 28 | 8.5 |
|---|
>PTW3C_KLEPN (P45604) PTS system N-acetylglucosamine-specific EIICBA component| (EIICBA-Nag) (EII-Nag) [Includes: N-acetylglucosamine permease IIC component (PTS system N-acetylglucosamine-specific EIIC component); N-acetylglucosamine-specific phosphotrans Length = 651 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +1 Query: 100 PGAGLSMYXNTPRXRRPXHAGF--------FXTGRPPPSRFL 201 PGA L+MY P+ RRP G F TG P FL Sbjct: 242 PGAALAMYLAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFL 283
>PTW3C_ECOLI (P09323) PTS system N-acetylglucosamine-specific EIICBA component| (EIICBA-Nag) (EII-Nag) [Includes: N-acetylglucosamine permease IIC component (PTS system N-acetylglucosamine-specific EIIC component); N-acetylglucosamine-specific phosphotrans Length = 648 Score = 29.6 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +1 Query: 100 PGAGLSMYXNTPRXRRPXHAGF--------FXTGRPPPSRFL 201 PGA L+MY P+ RRP G F TG P FL Sbjct: 242 PGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFL 283
>R3HD1_HUMAN (Q15032) R3H domain-containing protein 1| Length = 1099 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 82 QPSRPGPGAGLSMYXNTPRXRRPXHAGFFXTGRPPP 189 QPS G +M+ +T + P +G+ T PPP Sbjct: 556 QPSADGSDPHAAMFQSTVVLQSPQQSGYIMTAAPPP 591
>DNJB2_HUMAN (P25686) DnaJ homolog subfamily B member 2 (Heat shock 40 kDa| protein 3) (DnaJ protein homolog 1) (HSJ-1) Length = 351 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 206 QHRKREGGGRPVXKXPAWXG-RRXRGV 129 QHR R+G RP K AW G RR RGV Sbjct: 280 QHR-RQGRPRPSTKIQAWGGPRRVRGV 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,432,171 Number of Sequences: 219361 Number of extensions: 368268 Number of successful extensions: 1160 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)