| Clone Name | baal2d08 |
|---|---|
| Clone Library Name | barley_pub |
>RAG1_KLULA (P18631) Low-affinity glucose transporter (Hexose transporter 1)| Length = 567 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 55 SMVNW*VSFLVGKLVEFVLS--FFFFRYIFMMCLAVA 159 S NW FL+G F+ S F++ Y+FM C+ A Sbjct: 469 SASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFA 505
>SYLM_SCHPO (Q09828) Putative leucyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.4) (Leucine--tRNA ligase) (LeuRS) Length = 874 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 141 HKNITKEKKGKNE--LYQFPYKKGHLPINHAEIFRFYESMSXY 19 H K KGK + L FPY G L I H ++ + +S Y Sbjct: 48 HYPFVKNDKGKKKYILSMFPYPSGLLHIGHVRVYTISDILSRY 90
>SYLM_NEUCR (P15181) Leucyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.4) (Leucine--tRNA ligase) (LeuRS) Length = 994 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -1 Query: 147 THHKNITKEKKGKNELYQFPYKKGHLPINHAEIFRFYESMSXY 19 + K +++K K L FPY GHL + H ++ + ++ + Sbjct: 74 SREKGNKEDEKNKYVLPMFPYPSGHLHLGHLRVYTIADVIARF 116
>SYLM_SACDO (P13503) Leucyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.4) (Leucine--tRNA ligase) (LeuRS) Length = 894 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 138 KNITKEKKGKNELYQFPYKKGHLPINHAEIFRFYESMSXY 19 K T + K L QFPY G L I H ++ +S++ + Sbjct: 40 KQGTLNNRSKYILCQFPYPSGVLHIGHLRVYVISDSLNRF 79
>LEU1_RHILO (Q98HN3) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 558 Score = 27.7 bits (60), Expect = 8.4 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = -1 Query: 162 TSYS*THHKNITKE----KKGKNELYQFPYKKGHLPINHAEIFRFYESM 28 T++S +H I K KK L++ PY LPI+ A++ R YE++ Sbjct: 330 TAFSGSHQDAINKGMKALKKANTSLWEVPY----LPIDPADVGRSYEAI 374
>HXT5_YEAST (P38695) Probable glucose transporter HXT5| Length = 592 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 55 SMVNW*VSFLVGKLVEFVLSF--FFFRYIFMMCLAVA 159 S NW FL+ F+ S F++ Y+FM C+ A Sbjct: 490 SACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFA 526
>HXT3_YEAST (P32466) Low-affinity glucose transporter HXT3| Length = 567 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 64 NW*VSFLVGKLVEFVLSF--FFFRYIFMMCLAVA 159 NW FL+G F+ F++ Y+FM C+ A Sbjct: 469 NWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFA 502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,504,998 Number of Sequences: 219361 Number of extensions: 393202 Number of successful extensions: 816 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)