| Clone Name | baal2b16 |
|---|---|
| Clone Library Name | barley_pub |
>SRCA_MOUSE (Q7TQ48) Sarcalumenin precursor| Length = 910 Score = 36.2 bits (82), Expect = 0.064 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = -1 Query: 187 APGANGLRLHYHGAATLTVLDQAPHGAVASANSRYPAWRRHLSHEGEKPSSTAPPSAIAG 8 APG L LHY L+Q P GA ++AN + LS+ + +APP + G Sbjct: 60 APGDKNLLLHYPDGREAESLEQTPAGAPSTANGQGSETEASLSN--TSAAESAPPGDVEG 117 Query: 7 P 5 P Sbjct: 118 P 118
>TRUB_MOOTA (Q2RJM2) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 305 Score = 29.6 bits (65), Expect = 6.0 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Frame = +1 Query: 55 HATDGVAMPGTGCLLMPPLRE------EPGRG-LSA*PRRGNASGGRWLLVPHPITR 204 H ++GVA+ G C +P LRE E G G L A R + G +LL PH + + Sbjct: 249 HVSNGVAIKGDVCRPLPSLREGDIVRLETGEGQLLALARVEPDTRGSFLLKPHKVLK 305
>POXB_STRPN (Q54970) Pyruvate oxidase (EC 1.2.3.3) (Pyruvic oxidase) (POX)| Length = 591 Score = 29.3 bits (64), Expect = 7.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 37 WRASPLHATDGVAMPG 84 WR SPL AT G+A+PG Sbjct: 407 WRTSPLFATMGIALPG 422
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 29.3 bits (64), Expect = 7.9 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 9/98 (9%) Frame = -1 Query: 292 RDWLAWSMAASPSLYTGESPTLAVQLASIL**WGEAPGANGLRLHYHGAATL--TVLDQA 119 RD L+ + A P + T + L V IL GE NG+ LH + L T + A Sbjct: 261 RDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPESA 320 Query: 118 --PHGAVASANSRYP-----AWRRHLSHEGEKPSSTAP 26 P SA+ P +W L H+ KPSS++P Sbjct: 321 SPPADGTGSASGTLPVSQPKSW-ASLFHD-SKPSSSSP 356
>B2L12_HUMAN (Q9HB09) Bcl-2-related proline-rich protein (Bcl-2-like 12 protein)| Length = 334 Score = 29.3 bits (64), Expect = 7.9 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 8/100 (8%) Frame = +1 Query: 16 WQREEPCWRASPLHATDGVAMPGTGCLLMPPLREEPGRGLSA*PRRGNASGGRWLLVPHP 195 W+R + WR G +M G+ L LRE+ R L+A RRG A+G P Sbjct: 65 WRRPQVEWRRRRWGPGPGASMAGSEEL---GLREDTLRVLAAFLRRGEAAGSPVPTPPRS 121 Query: 196 ITRGWRPAGRPRL-VILPCTV-------RAKQPCSKPTNP 291 + RL LPC++ + +PCS P P Sbjct: 122 PAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRP 161
>AMYD_THETU (P37730) Probable starch degradation products transport system| permease protein amyD Length = 292 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 333 FFFFHCFVHTIDSTGIGWLGAWL 265 F F F D+T IGWLG WL Sbjct: 127 FIFVDVFQTISDATHIGWLGGWL 149
>OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinase)| (Obscurin-MLCK) (Obscurin-RhoGEF) Length = 7968 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 163 LHYHGAATLTVLDQAPHGAVASANSRYPAWRRHLSHEG 50 L YH A + HGA+A + R+PA RRHL G Sbjct: 6873 LFYHQAG-----ESPEHGALAPGSRRHPARRRHLLKGG 6905 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,614,276 Number of Sequences: 219361 Number of extensions: 1579389 Number of successful extensions: 4639 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4633 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)