| Clone Name | baal1m10 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_ENMGO (P12296) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D)] (Fragment) Length = 834 Score = 32.3 bits (72), Expect = 0.89 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 295 TSTAPTTKVIHE-GMLGTGRFPLGKFSGPGTATGICVAV 182 T T PTT+V+HE L GR P +GPGT+ I V Sbjct: 707 TPTKPTTQVLHEVSSLSEGRTPQVYSAGPGTSNQISFVV 745
>POLG_EMCV (P03304) Genome polyprotein [Contains: Coat protein VP4 (Rho); Coat| protein VP2 (Beta); Coat protein VP3 (Gamma); Coat protein VP1 (Alpha); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (G); Core protein P2B (I); Core protein P2C (C); Core pro Length = 2290 Score = 30.0 bits (66), Expect = 4.4 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 295 TSTAPTTKVIHE-GMLGTGRFPLGKFSGPGTATGICVAV 182 T T PTT+V+HE L GR P +GPG + I V Sbjct: 772 TPTKPTTQVLHEVSSLSEGRTPQVYSAGPGISNQISFVV 810
>POLG_EMCVB (P17593) Genome polyprotein [Contains: Coat protein VP4 (Rho); Coat| protein VP2 (Beta); Coat protein VP3 (Gamma); Coat protein VP1 (Alpha); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (G); Core protein P2B (I); Core protein P2C (C); Core pr Length = 2292 Score = 29.6 bits (65), Expect = 5.8 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 295 TSTAPTTKVIHE-GMLGTGRFPLGKFSGPGTATGICVAV 182 T T PTT+V+HE L GR P +GPG I V Sbjct: 774 TPTKPTTQVLHEVSSLSEGRTPQVYSAGPGITNQISFVV 812
>HR4_DROME (Q9W539) Hormone receptor 4 (dHR4)| Length = 1518 Score = 29.3 bits (64), Expect = 7.6 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +3 Query: 168 NLPIRTATQIPVAVPGPENLPRGNLPVPNMPSWMTLVVGAVLVAI 302 +LP+ A +P+A+P P +LP LP+ S +T+ + AV+ A+ Sbjct: 69 SLPLPLALPLPMALPLPMSLP---LPLTAASSAVTVSLAAVVAAV 110
>POLG_TBEVW (P14336) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3414 Score = 29.3 bits (64), Expect = 7.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 191 TNPRSCSRPRKFAERKSPCAQHAFMDDLGRWCRA 292 + PR CSR A+ KS A A+ D+ RW A Sbjct: 2901 SKPRMCSREEFIAKVKSNAALGAWSDEQNRWASA 2934
>POLG_TBEVH (Q01299) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3414 Score = 29.3 bits (64), Expect = 7.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 191 TNPRSCSRPRKFAERKSPCAQHAFMDDLGRWCRA 292 + PR CSR A+ KS A A+ D+ RW A Sbjct: 2901 SKPRMCSREEFIAKVKSNAALGAWSDEQNRWASA 2934
>TREX2_HUMAN (Q9BQ50) Three prime repair exonuclease 2 (EC 3.1.11.2) (3'-5'| exonuclease TREX2) Length = 279 Score = 28.9 bits (63), Expect = 9.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 194 LCCCPDRQVMVGAPELHGKDSRAMSRC 114 LC CP+R A E+ G S ++RC Sbjct: 105 LCMCPERPFTAKASEITGLSSEGLARC 131
>POLG_TBEVS (P07720) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3412 Score = 28.9 bits (63), Expect = 9.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 191 TNPRSCSRPRKFAERKSPCAQHAFMDDLGRWCRA 292 + PR CSR A+ KS A A+ D+ RW A Sbjct: 2899 SKPRMCSREEFIAKVKSNAALGAWSDEQNRWSSA 2932 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,527,904 Number of Sequences: 219361 Number of extensions: 1466466 Number of successful extensions: 4003 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4001 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)