| Clone Name | baal1l05 |
|---|---|
| Clone Library Name | barley_pub |
>YWZ5_CAEEL (Q11095) Hypothetical protein C02B8.5| Length = 453 Score = 34.3 bits (77), Expect = 0.080 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 246 NTIWCSRCEIWWKWRDVPVDKY 181 N+ WC C + W+WR +P D Y Sbjct: 412 NSEWCGLCNLCWQWRKLPADYY 433
>PFA5_YEAST (Q03289) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 374 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 300 YDKYRIDECIRADPIGHGNTIWCSRCE 220 YD +C ++DP HG IWCS C+ Sbjct: 111 YDAVVPPKCYQSDP--HGYPIWCSECQ 135
>FPG_BDEBA (Q6ML45) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 269 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 324 FRLYSMTMYDKYRIDECIRADPIGHGNTIWCSRCE 220 FR+Y + +++ +G NT WCSRC+ Sbjct: 234 FRVYGRDKEPCVTCGQQVKSKVLGGRNTFWCSRCQ 268
>FER_THEAC (P00218) Zinc-containing ferredoxin| Length = 142 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 300 YDKYRIDECIRADPIGHGNTIWCSRCE 220 ++KYR D+C DP+ + I+C CE Sbjct: 107 WNKYRTDKC---DPVRESDCIFCMACE 130
>SYT_MANSM (Q65TQ0) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 643 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = +3 Query: 168 DKFLRTCRPARLAI--STIFRTDYTILYFH-----VLLGPHVYTHRFCIYHTL 305 D F + P ++AI I + D+ LY H + GPHV RFC + L Sbjct: 146 DTFEKRGEPYKMAILDENIAKDDHPALYHHEEYIDMCRGPHVPNMRFCHHFKL 198
>RHOC_MOUSE (Q62159) Rho-related GTP-binding protein RhoC precursor| (Silica-induced gene 61 protein) (SIG-61) Length = 193 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 226 VRNMVEMARRAGRQVRKN 173 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>RHOC_HUMAN (P08134) Rho-related GTP-binding protein RhoC precursor (H9)| Length = 193 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 226 VRNMVEMARRAGRQVRKN 173 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>LTB1S_HUMAN (P22064) Latent transforming growth factor beta-binding protein,| isoform 1S precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1394 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -2 Query: 285 IDECIRADPIGHG---NTIWCSRCE 220 +DEC+R D G G NT+ RCE Sbjct: 631 VDECLRPDVCGEGHCVNTVGAFRCE 655
>LTB1L_HUMAN (Q14766) Latent transforming growth factor beta-binding protein,| isoform 1L precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1595 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -2 Query: 285 IDECIRADPIGHG---NTIWCSRCE 220 +DEC+R D G G NT+ RCE Sbjct: 832 VDECLRPDVCGEGHCVNTVGAFRCE 856
>GLGB_SOLTU (P30924) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Starch| branching enzyme) (Q-enzyme) Length = 861 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 252 HGNTIWCSRCEIWWKWRDVPVDKYAKIY 169 HGN +W R W K+ K+A Y Sbjct: 213 HGNGVWVDRIPAWIKYATADATKFAAPY 240
>PFA5_CANGA (Q6FMP5) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 352 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 276 CIRADPIGHGNTIWCSRCE 220 C ++DP HG +WCS C+ Sbjct: 104 CYQSDP--HGYPVWCSNCQ 120
>ENV_HV1J3 (P12489) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 867 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +1 Query: 46 PVSTATQRNARNNYSELYIYDAVSAKXASRVCPAGDGEP**INFC 180 P++ +T+ N +N+ S Y + + ++ CP EP I++C Sbjct: 186 PINNSTKDNIKNDNSTRYRLISCNTSVITQACPKISFEPIPIHYC 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,598,696 Number of Sequences: 219361 Number of extensions: 784583 Number of successful extensions: 2083 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2083 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)