| Clone Name | baal1k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACCD_ADICA (Q85FL3) Acetyl-coenzyme A carboxylase carboxyl trans... | 31 | 2.4 | 2 | RARB_COTJA (Q9W6B3) Retinoic acid receptor beta (RAR-beta) | 30 | 5.3 | 3 | TRUD_IDILO (Q5QUC5) tRNA pseudouridine synthase D (EC 5.4.99.-) ... | 29 | 9.0 | 4 | MSHR_HORSE (P79166) Melanocyte-stimulating hormone receptor (MSH... | 29 | 9.0 |
|---|
>ACCD_ADICA (Q85FL3) Acetyl-coenzyme A carboxylase carboxyl transferase subunit| beta (EC 6.4.1.2) (ACCase beta chain) Length = 310 Score = 31.2 bits (69), Expect = 2.4 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 307 NKLL*LSMPSNLLKGSLTTISSLYIS 230 N LL L +P NLLKG L+ IS LY+S Sbjct: 279 NGLLDLIVPRNLLKGVLSEISGLYLS 304
>RARB_COTJA (Q9W6B3) Retinoic acid receptor beta (RAR-beta)| Length = 455 Score = 30.0 bits (66), Expect = 5.3 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 202 PTS--STRSPASIYTEMILSSETLSINLRALTITKVYSGDCALLDGSSSKHYGL 357 PTS ST SPAS+ T+ S E + L +VY D SS HYG+ Sbjct: 49 PTSGCSTPSPASVETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGV 102
>TRUD_IDILO (Q5QUC5) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 350 Score = 29.3 bits (64), Expect = 9.0 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 202 PTSSTRSPASIYTEMILS---SETLSINLRALTITKVYSGDCALLDGSSS 342 P +RS S+Y + S +E ++ +R I +GDC +L+GS S Sbjct: 189 PPRISRSKRSLYLSALRSYLFNEIVAERIRQFGIEGTLTGDCVMLEGSQS 238
>MSHR_HORSE (P79166) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 317 Score = 29.3 bits (64), Expect = 9.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 285 IDNYKSLFWGLRFTGRIFFKALWVDIVSIW 374 +D Y S+F+ LR+ + +W IV+IW Sbjct: 140 VDRYISIFYALRYHSIMMLPRVWRAIVAIW 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,963,069 Number of Sequences: 219361 Number of extensions: 1561365 Number of successful extensions: 4747 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4746 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)