| Clone Name | baal1j22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RER1A_ARATH (O48670) RER1A protein (AtRER1A) | 90 | 5e-20 | 2 | RER1B_ARATH (O48671) RER1B protein (AtRER1B) | 88 | 2e-19 | 3 | RER1C_ARATH (Q9ZWI7) RER1C protein (AtRER1C) | 79 | 1e-14 | 4 | RER1_MOUSE (Q9CQU3) RER1 protein | 72 | 1e-12 | 5 | RER1_HUMAN (O15258) RER1 protein | 72 | 1e-12 | 6 | YAF8_CAEEL (P52879) Hypothetical protein F46C5.8 in chromosome II | 71 | 2e-12 | 7 | RER1_YEAST (P25560) Protein RER1 (Retention of ER proteins 1) | 71 | 2e-12 | 8 | RER1_SACPS (P79003) Protein RER1 (Retention of ER proteins 1) | 70 | 5e-12 | 9 | RER1_SCHPO (Q10358) Protein rer1 (Retention of ER proteins 1) | 64 | 2e-10 |
|---|
>RER1A_ARATH (O48670) RER1A protein (AtRER1A)| Length = 191 Score = 90.1 bits (222), Expect(2) = 5e-20 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFFSVFDVPVFWPILLCYWIVLFVLTM+RQI HM+KYKY+PF Sbjct: 132 TFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPF 173 Score = 26.9 bits (58), Expect(2) = 5e-20 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 2 WYAITXXFCVAFVM 43 WY++T FC+AF+M Sbjct: 118 WYSMTKAFCIAFLM 131
>RER1B_ARATH (O48671) RER1B protein (AtRER1B)| Length = 195 Score = 87.8 bits (216), Expect(2) = 2e-19 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFFSVFDVPVFWPILLCYW+VLFVLTM+RQI HM+K+KY+PF Sbjct: 131 TFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPF 172 Score = 26.9 bits (58), Expect(2) = 2e-19 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 2 WYAITXXFCVAFVM 43 WY++T FC+AF+M Sbjct: 117 WYSMTKAFCIAFLM 130
>RER1C_ARATH (Q9ZWI7) RER1C protein (AtRER1C)| Length = 212 Score = 78.6 bits (192), Expect = 1e-14 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFF VFDVPVFWPILL YW++LF LTM++QI HM+KY+YVPF Sbjct: 153 TFFEVFDVPVFWPILLFYWVMLFFLTMRKQIQHMIKYRYVPF 194
>RER1_MOUSE (Q9CQU3) RER1 protein| Length = 196 Score = 72.0 bits (175), Expect = 1e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFF F+VPVFWPIL+ Y+I+LF +TMKRQI HM+KY+Y+PF Sbjct: 136 TFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPF 177
>RER1_HUMAN (O15258) RER1 protein| Length = 196 Score = 72.0 bits (175), Expect = 1e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFF F+VPVFWPIL+ Y+I+LF +TMKRQI HM+KY+Y+PF Sbjct: 136 TFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPF 177
>YAF8_CAEEL (P52879) Hypothetical protein F46C5.8 in chromosome II| Length = 191 Score = 70.9 bits (172), Expect = 2e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 TFF FDVPVFWPIL+ Y+ +L LT+KRQI+HM+KY+Y+PF Sbjct: 131 TFFEFFDVPVFWPILVMYFFILTFLTLKRQIMHMIKYRYIPF 172
>RER1_YEAST (P25560) Protein RER1 (Retention of ER proteins 1)| Length = 188 Score = 70.9 bits (172), Expect = 2e-12 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVP 167 + FS+FD+PVFWPILL Y+I+LF LTM+RQI HM+KY+Y+P Sbjct: 135 SLFSIFDIPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIP 175
>RER1_SACPS (P79003) Protein RER1 (Retention of ER proteins 1)| Length = 188 Score = 69.7 bits (169), Expect = 5e-12 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVP 167 + FS+FD+PVFWPILL Y+++LF LTM+RQI HM+KY+Y+P Sbjct: 135 SLFSIFDIPVFWPILLMYFVLLFFLTMRRQIQHMMKYRYIP 175
>RER1_SCHPO (Q10358) Protein rer1 (Retention of ER proteins 1)| Length = 184 Score = 64.3 bits (155), Expect = 2e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 45 TFFSVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPF 170 +FF +FDVPVFWPIL+ Y++VL +RQI HM+KY+YVPF Sbjct: 133 SFFRIFDVPVFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPF 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,925,212 Number of Sequences: 219361 Number of extensions: 1446894 Number of successful extensions: 3591 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3591 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)