| Clone Name | baal1h12 |
|---|---|
| Clone Library Name | barley_pub |
>R1B19_SOLDE (Q6L406) Putative late blight resistance protein homolog R1B-19| Length = 1582 Score = 33.5 bits (75), Expect = 0.47 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 123 KAMKAVSALVGIDSLSVDMATRKMTVIGMVDPVDVVS--KLRKAWSASI 263 KA K + GI+S+S D +K+TV G VD +S + KAW A + Sbjct: 1375 KAFKRLFLCPGIESVSTDRKEKKLTVTGDVDAGSSISCGETEKAWHARV 1423
>R1A3_SOLDE (Q6L440) Putative late blight resistance protein homolog R1A-3| Length = 760 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +3 Query: 126 AMKAVSALVGIDSLSVDMATRKMTVIGMVDPVDV 227 A K +++L G+DS+S+DM +K+TV G ++ +V Sbjct: 714 AFKRLASLPGVDSISIDMIEKKLTVGGDMNANEV 747
>ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1)| Length = 545 Score = 30.4 bits (67), Expect = 4.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 561 RAFLSRWRRSWGSPPCSARRSGCSCRGCGKPNKPTYT 451 +AF +R R G PC CSC C P T T Sbjct: 149 KAFENRQRSHTGQRPCKECGQACSCLSCQSPPMKTQT 185
>LCE2D_HUMAN (Q5TA82) Late cornified envelope protein 2D (Late envelope protein| 12) (Small proline-rich-like epidermal differentiation complex protein 1A) Length = 110 Score = 30.0 bits (66), Expect = 5.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 113 PCRCSAPASPQFSSTCXPRCELRTRPAGGGAVTDXPG 3 P +C AP SP SS C P P+ GG + G Sbjct: 33 PPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGG 69
>NINAC_DROME (P10676) Neither inactivation nor afterpotential protein C (EC| 2.7.11.1) Length = 1501 Score = 29.6 bits (65), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 408 PPQPTEQQLAELMNQYRSAYSAYHNPYMNNHYVVQSMEENPNS 536 P Q Q+ MN Y +AY++Y++ Y N ++ V NS Sbjct: 1278 PQQLRRNQMQMNMNAYNNAYNSYNSNYNNQNWGVHRSGSRRNS 1320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,197,227 Number of Sequences: 219361 Number of extensions: 734614 Number of successful extensions: 2715 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2710 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)