ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal1e10 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 35.8 bits (81), Expect = 0.060 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTPSGPRPRRWP 204 P P + + P RR PSP P RRR +P P PR RR P Sbjct: 531 PSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPP-PRRRRTP 573 Score = 33.1 bits (74), Expect = 0.39 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 73 PHPHLQHRTKKPADP--NRRVPSPLPIRRRWRAAPTPSGPRPRRW 201 P P + R+ PA P RR P+P P RR P P PRR+ Sbjct: 552 PPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRY 596
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 33.9 bits (76), Expect = 0.23 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRR-VPSPLPIRRRWRAAPTPSGPRPRRWP 204 P P + R K+P+ RR PSP P RRR +P P PR RR P Sbjct: 524 PSPSPRKRQKEPSPRRRRRSPSPPPARRRRSPSPPPP-PRRRRSP 567 Score = 30.0 bits (66), Expect = 3.3 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSP-LPIRRRWRAAPTPSGPRPRRW 201 P P + R+ P P RR SP LP RR P P PRR+ Sbjct: 546 PPPARRRRSPSPPPPPRRRRSPSLPRRRSPSPPPRRRSPSPRRY 589
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 33.1 bits (74), Expect = 0.39 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 73 PHPHLQHRTKKPADP--NRRVPSPLPIRRRWRAAPTPSGPRPRRW 201 P P + R+ PA P RR P+P P RR P P PRR+ Sbjct: 566 PPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRY 610 Score = 30.0 bits (66), Expect = 3.3 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +1 Query: 121 RRVPSPLPIRRRWRAAPTPSGPRPRRWP 204 RR PSP P RRR +P P PR RR P Sbjct: 561 RRSPSPPPTRRRRSPSPAPP-PRRRRTP 587
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 32.3 bits (72), Expect = 0.66 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTPS-GPRPRRWPGT 210 P P Q R + + P P P P R P P PRPR W G+ Sbjct: 104 PRPRPQPRARSRSQPGLSAPPPPPARPPPPPPPPPPPAPRPRAWRGS 150
>IF2_TROWT (Q83GT8) Translation initiation factor IF-2| Length = 803 Score = 32.0 bits (71), Expect = 0.87 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 100 KKPADPNRRVPSPLPIRR---RWRAAPTPSG 183 KKPA +RRVP+PLP +R R R AP G Sbjct: 142 KKPASTHRRVPAPLPQKRTPLRGRGAPGAFG 172
>IF2_TROW8 (Q83HG7) Translation initiation factor IF-2| Length = 803 Score = 32.0 bits (71), Expect = 0.87 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 100 KKPADPNRRVPSPLPIRR---RWRAAPTPSG 183 KKPA +RRVP+PLP +R R R AP G Sbjct: 142 KKPASTHRRVPAPLPQKRTPLRGRGAPGAFG 172
>TOP2_PENCH (Q9Y8G8) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1587 Score = 31.2 bits (69), Expect = 1.5 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 94 RTKKPADPNRRVPSPLPIRRRWRAAPTPSGPRPR 195 R K P R+P PLP RR R+ P P PR R Sbjct: 1553 RRKMLPKPPPRLPCPLPQRRTHRSNPRPRRPRRR 1586
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2160 Score = 30.8 bits (68), Expect = 1.9 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTPSGPRPRRWP 204 P P+L P P P P P+ R P P GPRP WP Sbjct: 831 PPPYL---ASYPGFPENGAPGP-PVSRFPLEEPAPPGPRPLPWP 870
>AROC_THEVO (Q97AR9) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 366 Score = 30.4 bits (67), Expect = 2.5 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 12/76 (15%) Frame = +3 Query: 159 EGGADAFGSSTAPLAWHDFLERMRQPSAA----EFVKSI--------KGFIMNFSNRAPD 302 EGG G TAPL L + S ++KSI +G NF R PD Sbjct: 122 EGGGFLSGRMTAPLVAAGALAKSYLDSLGIKITSYMKSIGEVTCDEIRGDPYNFETRIPD 181 Query: 303 PERDSAAVQEFLENME 350 PE++S A ++ M+ Sbjct: 182 PEKNSLATSLLVDIMK 197
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 27.3 bits (59), Expect(2) = 3.2 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTP--SGPRPRR 198 PHP Q R ++ + R SP+PIR A +GP P R Sbjct: 892 PHPPPQQRLRRGSYSRSRSRSPIPIRGNGPAGRDTGRAGPAPAR 935 Score = 21.2 bits (43), Expect(2) = 3.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 11 RNPESPRRQGHPRRAGEPLTS 73 R+P P +G+P R P+++ Sbjct: 849 RSPSPPPARGYPTRGRAPVSN 869
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 8 YRNPESPRRQGHPRRAGEPLTSPTPIFSIEPK 103 +R P P R GHP PTPI+S P+ Sbjct: 166 HRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQ 197
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.6 bits (65), Expect = 4.3 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 9/52 (17%) Frame = +1 Query: 73 PHPHLQHRTKKPADP---------NRRVPSPLPIRRRWRAAPTPSGPRPRRW 201 P P + R+ PA P RR P+P P RR P P PRR+ Sbjct: 564 PPPARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRY 615 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 121 RRVPSPLPIRRRWRAAPTPSGPRP 192 RR PSP P RRR +P P P P Sbjct: 559 RRSPSPPPARRRRSPSPAPPPPPP 582
>PUM1_MOUSE (Q80U78) Pumilio homolog 1| Length = 1189 Score = 29.3 bits (64), Expect = 5.6 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Frame = +1 Query: 79 PHLQHRTKKPADPNRRV---------PSPLPIRRRWRAAPTPSGPRP 192 PHL+H ++PA+PN V P P + AA T S P P Sbjct: 20 PHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVP 66
>PUM1_HUMAN (Q14671) Pumilio homolog 1 (Pumilio-1) (HsPUM)| Length = 1186 Score = 29.3 bits (64), Expect = 5.6 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Frame = +1 Query: 79 PHLQHRTKKPADPNRRV---------PSPLPIRRRWRAAPTPSGPRP 192 PHL+H ++PA+PN V P P + AA T S P P Sbjct: 20 PHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVP 66
>IF2_CORDI (Q6NGN2) Translation initiation factor IF-2| Length = 953 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 67 DLPHPHLQHRTKKPADPNRRVPSP--LPIRRRWRAAPTPSGPRP 192 + P + + KKPA P P P P + AAP P+ P+P Sbjct: 59 EAPAASQEPKAKKPAAPKPAAPKPAATPQQAAKPAAPKPAAPKP 102
>ACK1_MOUSE (O54967) Activated CDC42 kinase 1 (EC 2.7.10.2) (ACK-1)| (Non-receptor protein tyrosine kinase Ack) (Tyrosine kinase non-receptor protein 2) Length = 1055 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 103 KPADPNRRVPSPLPIRRRWRAAPTPSG-PRPRRWPG 207 KP P R P P R R +P PSG RWPG Sbjct: 751 KPQVPPRVPIPPRPTRPRVELSPAPSGEEETSRWPG 786
>APD14_APIME (Q06601) Apidaecins type 14 precursor [Contains: Apidaecin-2| (Apidaecin II); Apidaecin-1B (Apidaecin IB); Apidaecin-1A (Apidaecin IA)] Length = 168 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +1 Query: 73 PHPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTPSGPRPRRWP 204 PHP L+ + A+P P +P P P PR RR P Sbjct: 84 PHPRLRREAESEAEPGNNRPVYIP-------QPRPPHPRLRREP 120
>ACOT2_MOUSE (Q9QYR9) Acyl-coenzyme A thioesterase 2, mitochondrial precursor| (EC 3.1.2.2) (Acyl-CoA thioesterase 2) (Acyl coenzyme A thioester hydrolase) (Very-long-chain acyl-CoA thioesterase) (MTE-I) Length = 453 Score = 28.5 bits (62), Expect = 9.6 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 272 KALDGLDKFGGGRLAHALEE---VVPGQRRGRGPEG 174 + LDG + GG RLAHA+ E + PG RR EG Sbjct: 148 EVLDGHEPDGGQRLAHAVHERHFLAPGVRRVPVREG 183
>HTPG_GLUOX (Q5FS51) Chaperone protein htpG (Heat shock protein htpG) (High| temperature protein G) Length = 623 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 47 RRAGEPLTSPTPIFSIEPKNPLIR 118 RR+G+ + + PI I PK+PLI+ Sbjct: 549 RRSGQAMPAMPPILEINPKHPLIK 572
>ACOT1_MOUSE (O55137) Acyl-coenzyme A thioesterase 1 (EC 3.1.2.2) (Acyl-CoA| thioesterase 1) (Inducible cytosolic acyl-coenzyme A thioester hydrolase) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) Length = 419 Score = 28.5 bits (62), Expect = 9.6 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 272 KALDGLDKFGGGRLAHALEE---VVPGQRRGRGPEG 174 + LDG + GG RLAHA+ E + PG RR EG Sbjct: 107 EVLDGHEPDGGQRLAHAVHERHFLAPGVRRVPVREG 142
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 76 HPHLQHRTKKPADPNRRVPSPLPIRRRWRAAPTPSGPRPRRWP 204 H H H P P + P P P +++ + P P P+ R P Sbjct: 47 HHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAP 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,314,807 Number of Sequences: 219361 Number of extensions: 1171255 Number of successful extensions: 5061 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 4302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5014 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
