| Clone Name | baal1c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN607_HUMAN (Q96SK3) Zinc finger protein 607 | 30 | 4.0 | 2 | CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-) | 30 | 5.3 | 3 | ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor | 29 | 6.9 | 4 | SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte ... | 29 | 9.0 |
|---|
>ZN607_HUMAN (Q96SK3) Zinc finger protein 607| Length = 371 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +2 Query: 380 EQSS*CKSCG-----IHHVILHLQTGFSCP*YDCGRCTLSEGCTLYYV 508 E+S CK CG H+I+H + S Y+C RC + C Y V Sbjct: 261 EKSYECKECGETFSHASHLIIHERIHTSDKPYECKRCGKAFHCASYLV 308
>CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-)| Length = 454 Score = 29.6 bits (65), Expect = 5.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 461 DCGRCTLSEGCTLYYVVD 514 D G+CT+S+ CT YY D Sbjct: 317 DTGKCTVSKNCTRYYTTD 334
>ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor| Length = 1470 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 173 AEDRRNDPSTPFSLSTNTELAEHQNDAPMQVSKGRPRR 60 + +R P++PFS +NT A++Q+ P K + R Sbjct: 1261 SSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGR 1298
>SLAF6_MOUSE (Q9ET39) SLAM family member 6 precursor (Lymphocyte antigen 108)| Length = 351 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 35 AATSVCLFFAWVFPLILALGRRSDVLQA 118 A S C W+FPL+ LG S+V Q+ Sbjct: 8 APDSACQRMVWLFPLVFCLGSGSEVSQS 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,878,112 Number of Sequences: 219361 Number of extensions: 1639319 Number of successful extensions: 4599 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4595 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)