| Clone Name | baal1c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GNAS_SCHMA (P30669) Guanine nucleotide-binding protein G(s), alp... | 28 | 6.8 | 2 | SWI10_SCHPO (Q06182) Mating-type switching protein swi10 | 27 | 8.9 |
|---|
>GNAS_SCHMA (P30669) Guanine nucleotide-binding protein G(s), alpha subunit| (Adenylate cyclase-stimulating G alpha protein) Length = 379 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -2 Query: 382 YPILTCTPPFQNIRHF----RDFTRRLHTKQNE 296 YP LTC +NIR RD +R+H +Q E Sbjct: 345 YPHLTCAVDTENIRRVFNDCRDIIQRMHLRQYE 377
>SWI10_SCHPO (Q06182) Mating-type switching protein swi10| Length = 252 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -2 Query: 286 TLKYVYIHPYVVYSAISK--KSY 224 +LKY ++HP +YS ISK KSY Sbjct: 84 SLKYHHLHPEYIYSRISKLGKSY 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,625,347 Number of Sequences: 219361 Number of extensions: 871459 Number of successful extensions: 1739 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1738 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)