| Clone Name | baal0d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRKL_MOUSE (P47941) Crk-like protein | 28 | 7.3 | 2 | SYD_PELUB (Q4FMP8) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspar... | 27 | 9.5 | 3 | TLE3_HUMAN (Q04726) Transducin-like enhancer protein 3 (ESG3) | 27 | 9.5 | 4 | PMPI_CHLTR (O84882) Probable outer membrane protein pmpI precurs... | 27 | 9.5 |
|---|
>CRKL_MOUSE (P47941) Crk-like protein| Length = 303 Score = 27.7 bits (60), Expect = 7.3 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = +2 Query: 107 LLRQINHILHQNRGSNTTKFPES*HKNDQIILVRIPLPTIG*TQG 241 L+R H H NR SN+ PE H Q PLPT+ T G Sbjct: 181 LVRSSPHGKHGNRNSNSYGIPEPAHAYAQ-PQTTTPLPTVASTPG 224
>SYD_PELUB (Q4FMP8) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 594 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 256 PDKVNPLGLTYCWKRNPHQYDLIILVSGFRK 164 P ++NP G Y + P Q+ +I+VSGF K Sbjct: 183 PSRLNP-GKFYALPQAPQQFKQLIMVSGFDK 212
>TLE3_HUMAN (Q04726) Transducin-like enhancer protein 3 (ESG3)| Length = 772 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +1 Query: 97 IVFSASSNQSHLTSEQRKQHNQVS*ILTQE*SNHIGEDSSSNNRLNP 237 + A +Q+HLT + K H+++ +H +SS+NN ++P Sbjct: 167 LALGALGSQAHLTVKDEKNHHEL---------DHRERESSANNSVSP 204
>PMPI_CHLTR (O84882) Probable outer membrane protein pmpI precursor| (Polymorphic membrane protein I) Length = 878 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 11 LRCDHVNLCIICCKLAGLQSSRTTKDPSPSSSLL-RQINHIL 133 +R DH+N C +C + + +DP ++LL + NH++ Sbjct: 1 MRPDHMNFCCLCAAILSSTAVLFGQDPLGETALLTKNPNHVV 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,918,860 Number of Sequences: 219361 Number of extensions: 799219 Number of successful extensions: 1702 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1702 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)