| Clone Name | baak4p20 |
|---|---|
| Clone Library Name | barley_pub |
>MS84D_DROME (Q01645) Male-specific sperm protein Mst84Dd| Length = 72 Score = 30.8 bits (68), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 184 PSDPCCVFCICPCSGPCHG 128 P PCC C PC GPC G Sbjct: 12 PCGPCCGPCCGPCCGPCCG 30 Score = 28.9 bits (63), Expect = 8.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 175 PCCVFCICPCSGPCHG 128 PCC C PC GPC G Sbjct: 19 PCCGPCCGPCCGPCCG 34
>CRTC3_ARATH (O04153) Calreticulin-3 precursor| Length = 424 Score = 30.8 bits (68), Expect = 2.2 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = +1 Query: 154 RYKRRN-RDHWDDYHDEL 204 RYKR N RD+ DDYHDEL Sbjct: 407 RYKRPNPRDYMDDYHDEL 424
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 30.0 bits (66), Expect = 3.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 184 PSDPCCVFCICPCSGPC 134 P PCC +CPC PC Sbjct: 43 PKSPCCTPKVCPCPTPC 59
>MS87F_DROME (P08175) Male-specific sperm protein Mst87F| Length = 56 Score = 29.6 bits (65), Expect = 5.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 184 PSDPCCVFCICPCSGPC 134 P PCC C PC GPC Sbjct: 5 PCGPCCGPCCGPCCGPC 21
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 29.6 bits (65), Expect = 5.0 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +3 Query: 327 DHEDHSYVTAGQTIPPILKSQKLGLGPEI*CCECNVHGQRCASF----CKQLLLIQIKRF 494 D ED +T + K+++LG C C Q C ++L+ +KRF Sbjct: 818 DSEDSRTITLNDCLDEFEKTEQLGEEDPWYCPTCKEFRQASKQMEIWRCPEILIFHLKRF 877 Query: 495 SSKKK 509 SS+++ Sbjct: 878 SSERR 882
>FTR_RHOBA (Q7UKZ8) Formylmethanofuran--tetrahydromethanopterin| formyltransferase (EC 2.3.1.101) (H4MPT formyltransferase) Length = 334 Score = 29.3 bits (64), Expect = 6.5 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 360 ALLSHRNDLRGQFNQFPSHETRNTSIIGSNYNAMFMS-NPSF 238 A + +L G FP TR+ S +GS Y A+F S N SF Sbjct: 205 AAIDAMRELPGIITPFPGGTTRSGSKVGSKYAALFASTNDSF 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,008,877 Number of Sequences: 219361 Number of extensions: 907074 Number of successful extensions: 2105 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2101 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)