| Clone Name | rbasdn18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 46 | 1e-04 | 2 | UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (E... | 35 | 0.18 | 3 | ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-rela... | 30 | 7.5 | 4 | OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanin... | 29 | 9.8 |
|---|
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 45.8 bits (107), Expect = 1e-04 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 4/96 (4%) Frame = -3 Query: 616 EGETAAEVMDRVQKKLRVPNEEFAKWKAAFISMNRPEYLQDIDAVSARFQRRDVYGAWEQ 437 +GE EVM R+Q L + +EF K+K A + R +Y+ + + G Sbjct: 1013 QGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMTGRHQYINEDEYEVNLKDFEPQPGNMSH 1072 Query: 436 ---YLGLEHTDTTPKRSYTANQNRHTY-EKPVKIYN 341 +LGL+H + PKRS R+TY EK +KI+N Sbjct: 1073 PRPWLGLDHFNKAPKRS------RYTYLEKAIKIHN 1102
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 35.0 bits (79), Expect = 0.18 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 6/80 (7%) Frame = -3 Query: 613 GETAAEVMDRVQKKLRVPNEEFAKWKAAFI---SMNRPEYLQDIDAVSARFQRRDVYGAW 443 GET ++ R+QK+L + +F+K K A + S +P YL D D V +YG Sbjct: 1048 GETLKDLKKRLQKRLGYNDTQFSKVKLAVLQAQSFGKPYYLTDDDEV--------LYGEL 1099 Query: 442 E---QYLGLEHTDTTPKRSY 392 E LGL+H Y Sbjct: 1100 EPQSHILGLDHPPANGSAQY 1119
>ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) Length = 500 Score = 29.6 bits (65), Expect = 7.5 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 586 RVQKKLRVPNEEFAKWKAAFISMNRPEYLQDIDAV 482 R KKL+V EEF KA ++ + Y++D++AV Sbjct: 329 RRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAV 363
>OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA| glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP lyase)] Length = 345 Score = 29.3 bits (64), Expect = 9.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -1 Query: 351 RSTIEKPSIWAACPCPDKGLI*ESVLKRPSDLNRREMLSNIWSFV 217 R+ P++WA+ PCP L + VL RE WS V Sbjct: 14 RTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGV 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,614,320 Number of Sequences: 219361 Number of extensions: 2227921 Number of successful extensions: 5022 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5021 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)