| Clone Name | rbasdn15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrin... | 35 | 0.037 | 2 | ZNF80_MACMU (P51505) Zinc finger protein 80 | 28 | 5.9 | 3 | ZNF80_PONPY (P51507) Zinc finger protein 80 | 28 | 5.9 | 4 | ZNF80_PANTR (P51506) Zinc finger protein 80 | 28 | 5.9 | 5 | ZNF80_GORGO (P51503) Zinc finger protein 80 | 28 | 5.9 |
|---|
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 35.4 bits (80), Expect = 0.037 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 301 NIXIXWXXXXXXXXXXXIVXRYLYMCXNHTPVASNDY 191 NI I W +V RY+YMC +H PVAS+++ Sbjct: 212 NIWIYWVGPLVGGGLAGLVYRYVYMCGDHAPVASSEF 248
>ZNF80_MACMU (P51505) Zinc finger protein 80| Length = 293 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 238 YLYMCXNHTPVASNDY*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 101 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 248 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 293
>ZNF80_PONPY (P51507) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 238 YLYMCXNHTPVASNDY*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 101 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273
>ZNF80_PANTR (P51506) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 238 YLYMCXNHTPVASNDY*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 101 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273
>ZNF80_GORGO (P51503) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 238 YLYMCXNHTPVASNDY*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 101 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,799,766 Number of Sequences: 219361 Number of extensions: 575294 Number of successful extensions: 1067 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)