| Clone Name | rbasdn12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZYX_MOUSE (Q62523) Zyxin | 31 | 3.6 | 2 | Y040_HAEIN (P43929) Hypothetical protein HI0040 | 30 | 6.1 | 3 | IGA3_HAEIN (P45385) Immunoglobulin A1 protease precursor (EC 3.4... | 30 | 7.9 | 4 | IGA1_HAEIN (P42782) Immunoglobulin A1 protease precursor (EC 3.4... | 30 | 7.9 |
|---|
>ZYX_MOUSE (Q62523) Zyxin| Length = 564 Score = 30.8 bits (68), Expect = 3.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -2 Query: 449 PDWHIDSSPEIVHQLSRFIKYQLHISPQQTERVSPNVFSSASLE 318 P W SS + Q R + QLH+ PQ V P SSA+ + Sbjct: 199 PPWKTPSSSQPPPQPQRKPQVQLHVQPQAKPHVQPQPVSSANTQ 242
>Y040_HAEIN (P43929) Hypothetical protein HI0040| Length = 258 Score = 30.0 bits (66), Expect = 6.1 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Frame = -2 Query: 611 DVYLMEHVLDDESEEKVLSALSEAGL----FTSGGLVREKVLFCSTENGRTSFVRQLEPD 444 D YL+EH + E+K+ + E L FT+ + + F E+ F+ +LE + Sbjct: 159 DTYLVEHSFHFDEEQKMFPFMDELSLGDYSFTTLQYSAQAIQF--NEDDEPYFLVKLEQE 216 Query: 443 WHIDSSPEIVHQLSRFIK 390 +++S EI Q+ RF K Sbjct: 217 ISLENS-EIFEQVERFEK 233
>IGA3_HAEIN (P45385) Immunoglobulin A1 protease precursor (EC 3.4.21.72) (IGA1| protease) Length = 1545 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 109 ISLSIAYGALQNKFSTSHNKTFTHNTRKTNCTIHQENKLNN 231 + + + YG Q+K T+HN F +T + T + L N Sbjct: 1379 LGIDLGYGKFQSKLQTNHNAKFARHTAQFGLTAGKAFNLGN 1419
>IGA1_HAEIN (P42782) Immunoglobulin A1 protease precursor (EC 3.4.21.72) (IGA1| protease) Length = 1541 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 109 ISLSIAYGALQNKFSTSHNKTFTHNTRKTNCTIHQENKLNN 231 + + + YG Q+K T+HN F +T + T + L N Sbjct: 1375 LGIDLGYGKFQSKLQTNHNAKFARHTAQFGLTAGKAFNLGN 1415 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,352,625 Number of Sequences: 219361 Number of extensions: 1905727 Number of successful extensions: 5313 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5309 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)