| Clone Name | rbasdg17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZNF45_HUMAN (Q02386) Zinc finger protein 45 (BRC1744) | 35 | 0.21 | 2 | ENV_EIAVC (P32541) Env polyprotein precursor (Coat polyprotein) ... | 33 | 0.60 | 3 | HXB3A_BRARE (O42368) Homeobox protein Hox-B3a (Hox-B3) | 33 | 0.78 | 4 | COG5_YEAST (P53951) Conserved oligomeric Golgi complex component... | 30 | 6.6 | 5 | BPAEA_HUMAN (O94833) Bullous pemphigoid antigen 1, isoforms 6/9/... | 30 | 8.7 |
|---|
>ZNF45_HUMAN (Q02386) Zinc finger protein 45 (BRC1744)| Length = 682 Score = 35.0 bits (79), Expect = 0.21 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = -2 Query: 672 KDLVTFKSSGYSATDAEKEAIDSANEKAEENTMLQNVDPVTDSSNVVASGEESKPDG 502 K+ VTFK ++ E + +D A K + ML+N NVV+ G +S PDG Sbjct: 5 KEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENF------RNVVSVGHQSTPDG 55
>ENV_EIAVC (P32541) Env polyprotein precursor (Coat polyprotein) [Contains:| Coat protein GP90; Coat protein GP45] Length = 859 Score = 33.5 bits (75), Expect = 0.60 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = -2 Query: 606 SANEKAEENTMLQNVDPVTDSSNVVASGEESKPDGSGAP--------RNVWWQKQLISLY 451 S K EENTM Q DS N +A +E++ RN WW+K + L Sbjct: 22 SEKSKCEENTMFQPYCYNNDSKNSMAESKEARDQEMNLKEESKEEKRRNDWWKKGMFLLC 81 Query: 450 RSAKESNKLW 421 + LW Sbjct: 82 LAGTTGGILW 91
>HXB3A_BRARE (O42368) Homeobox protein Hox-B3a (Hox-B3)| Length = 417 Score = 33.1 bits (74), Expect = 0.78 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Frame = -2 Query: 654 KSSGYSATDAEKEAIDSANEKAEENTMLQNVDPVTDSSNVVASGEESKPDGSGA---PRN 484 KSS + + I +++ +NT +N P S+N +SG E P GS A R Sbjct: 126 KSSSMATNPTLTKQIFPWMKESRQNTKQKNSSPSASSANAESSGGEKSPPGSAASKRART 185 Query: 483 VWWQKQLISL 454 + QL+ L Sbjct: 186 AYTSAQLVEL 195
>COG5_YEAST (P53951) Conserved oligomeric Golgi complex component 5 (Complexed| with DOR1 protein 4) Length = 403 Score = 30.0 bits (66), Expect = 6.6 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 14/68 (20%) Frame = -2 Query: 630 DAEKEAIDSANEKAEENTMLQNV--DPVTDSSNVVASGEE------------SKPDGSGA 493 DA E ++ T+LQN+ D VT+SS +A+ + GSG Sbjct: 272 DAFNEVVEKGYNIYILETLLQNIKTDNVTNSSRSIAANKSRLGNLLSEYTSMKSKAGSGT 331 Query: 492 PRNVWWQK 469 PR+++W K Sbjct: 332 PRDLFWSK 339
>BPAEA_HUMAN (O94833) Bullous pemphigoid antigen 1, isoforms 6/9/10| (Trabeculin-beta) (Bullous pemphigoid antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) Length = 5171 Score = 29.6 bits (65), Expect = 8.7 Identities = 20/70 (28%), Positives = 31/70 (44%) Frame = -2 Query: 633 TDAEKEAIDSANEKAEENTMLQNVDPVTDSSNVVASGEESKPDGSGAPRNVWWQKQLISL 454 TD E K+ E + QNV+ V + + + E PD APR W++ L + Sbjct: 2134 TDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPR---WKQMLTEI 2190 Query: 453 YRSAKESNKL 424 +E N+L Sbjct: 2191 DSKWQELNQL 2200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,172,079 Number of Sequences: 219361 Number of extensions: 2016163 Number of successful extensions: 6202 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6199 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)