| Clone Name | rbasdf24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VHS_HHV2H (P68340) Virion host shutoff protein | 30 | 1.4 | 2 | VHS_HHV2G (P68339) Virion host shutoff protein | 30 | 1.4 | 3 | VHS_HHV11 (P10225) Virion host shutoff protein | 28 | 5.3 | 4 | DPM1_USTMA (P54856) Dolichol-phosphate mannosyltransferase (EC 2... | 28 | 5.3 | 5 | POLG_JAEVJ (P32886) Genome polyprotein [Contains: Capsid protein... | 28 | 6.9 | 6 | POLG_JAEVN (P14403) Genome polyprotein [Contains: Capsid protein... | 28 | 6.9 |
|---|
>VHS_HHV2H (P68340) Virion host shutoff protein| Length = 492 Score = 30.4 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 7 PPXKVRTAXAVAITSH----GTRPRHCFHQAPHHLGRTPSRIGIDKLTKHHY 150 PP V+ A + H R RH H AP L P + I +L +H Y Sbjct: 366 PPELVQVPNAQRVAEHRGYVAGRRRHVIHDAPEALDWLPDPMTIAELVEHRY 417
>VHS_HHV2G (P68339) Virion host shutoff protein| Length = 492 Score = 30.4 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 7 PPXKVRTAXAVAITSH----GTRPRHCFHQAPHHLGRTPSRIGIDKLTKHHY 150 PP V+ A + H R RH H AP L P + I +L +H Y Sbjct: 366 PPELVQVPNAQRVAEHRGYVAGRRRHVIHDAPEALDWLPDPMTIAELVEHRY 417
>VHS_HHV11 (P10225) Virion host shutoff protein| Length = 489 Score = 28.5 bits (62), Expect = 5.3 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +1 Query: 7 PPXKVRTAXAVAITSH----GTRPRHCFHQAPHHLGRTPSRIGIDKLTKHHY 150 PP V+ A + H RH H AP L P + I +L +H Y Sbjct: 363 PPELVQVPNAQLLEEHRSYVANPRRHVIHDAPESLDWLPDPMTITELVEHRY 414
>DPM1_USTMA (P54856) Dolichol-phosphate mannosyltransferase (EC 2.4.1.83)| (Dolichol-phosphate mannose synthase) (Dolichyl-phosphate beta-D-mannosyltransferase) (Mannose-P-dolichol synthase) (MPD synthase) (DPM synthase) Length = 294 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 67 RHCFHQAPHHLGRTPSRIGIDKLTKHHYH 153 +H FH A HH+ +I +D L K H Sbjct: 195 KHSFHTADHHINAQGFKIALDLLVKSGVH 223
>POLG_JAEVJ (P32886) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 120 NSRWCTAEVVWGLVKTMSWPRAVTSDGDG 34 N W V+G VK+ +WP T GDG Sbjct: 1001 NDTWKLERAVFGEVKSCTWPETHTLWGDG 1029
>POLG_JAEVN (P14403) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 1440 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 120 NSRWCTAEVVWGLVKTMSWPRAVTSDGDG 34 N W V+G VK+ +WP T GDG Sbjct: 929 NDTWKLERAVFGEVKSCTWPETHTLWGDG 957 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,716,697 Number of Sequences: 219361 Number of extensions: 364475 Number of successful extensions: 1423 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1423 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)