| Clone Name | rbasdf22 |
|---|---|
| Clone Library Name | barley_pub |
>MYSC_ACACA (P10569) Myosin IC heavy chain| Length = 1168 Score = 31.2 bits (69), Expect = 2.6 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -1 Query: 515 SPGYPSTAGWPPPSVQA*LSLVSSRGYPRR*GSAPRSSGAP 393 +PG P G PPP RG P G+APR GAP Sbjct: 1075 APGGPGRGGAPPPGAGR-AGPPGGRGMPAPGGAAPRGRGAP 1114
>Y604_ENCCU (Q8SVF8) Hypothetical protein ECU06_0040| Length = 477 Score = 30.0 bits (66), Expect = 5.8 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = -3 Query: 549 GIYQNKERTDRIARIS-LYCWMASSVCASLVELGELKRLSKA-MRKRAKELRGADKYEDE 376 G + ER +RIA + + C +C L E L L++ M+K KE DK +D Sbjct: 72 GFLYSIERWERIAEVEKIVCNACKEICLGLREEELLGLLAEGGMKKTLKEEFSEDKAKDA 131 Query: 375 QYLGKMKQSDDRLL 334 +YL + D LL Sbjct: 132 RYLEYIVVDDVLLL 145
>Y7I9_ENCCU (Q8ST30) Hypothetical protein ECU07_1890/ECU10_0010| Length = 433 Score = 30.0 bits (66), Expect = 5.8 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = -3 Query: 549 GIYQNKERTDRIARIS-LYCWMASSVCASLVELGELKRLSKA-MRKRAKELRGADKYEDE 376 G + ER +RIA + + C +C L E L L++ M+K KE DK +D Sbjct: 35 GFLYSIERWERIAEVEKIVCNACKEICLGLREEELLGLLAEGGMKKTLKEEFSEDKAKDA 94 Query: 375 QYLGKMKQSDDRLL 334 +YL + D LL Sbjct: 95 RYLEYIVVDDVLLL 108
>YB03_ENCCU (Q8SU90) Hypothetical protein ECU11_0030| Length = 641 Score = 30.0 bits (66), Expect = 5.8 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = -3 Query: 549 GIYQNKERTDRIARIS-LYCWMASSVCASLVELGELKRLSKA-MRKRAKELRGADKYEDE 376 G + ER +RIA + + C +C L E L L++ M+K KE DK +D Sbjct: 243 GFLYSIERWERIAEVEKIVCNACKEICLGLREEELLGLLAEGGMKKTLKEEFSEDKAKDA 302 Query: 375 QYLGKMKQSDDRLL 334 +YL + D LL Sbjct: 303 RYLEYIVVDDVLLL 316
>KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-associated protein| 1.8) (Keratin-associated protein 1.9) Length = 177 Score = 30.0 bits (66), Expect = 5.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 599 CCRPSCSWTSSCG*G 555 CC+PSC TSSCG G Sbjct: 80 CCQPSCCQTSSCGTG 94
>PLCB2_HUMAN (Q00722) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| beta 2 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (Phospholipase C-beta-2) (PLC-beta-2) Length = 1181 Score = 30.0 bits (66), Expect = 5.8 Identities = 26/73 (35%), Positives = 34/73 (46%), Gaps = 5/73 (6%) Frame = -3 Query: 471 ASLVELGELKRLSKAMRKRAKEL-----RGADKYEDEQYLGKMKQSDDRLLALVKAGMDV 307 ASL EL ELK + K R+ KEL RGA ++E+ G + L + G Sbjct: 883 ASLEELRELKGVVKLQRRHEKELRELERRGARRWEELLQRGAAQ--------LAELGPPG 934 Query: 306 VVAVGLLQLAPKK 268 V VG +L P K Sbjct: 935 VGGVGACKLGPGK 947
>Y6G8_ENCCU (Q8SV57) Hypothetical protein ECU06_1680| Length = 458 Score = 30.0 bits (66), Expect = 5.8 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = -3 Query: 549 GIYQNKERTDRIARIS-LYCWMASSVCASLVELGELKRLSKA-MRKRAKELRGADKYEDE 376 G + ER +RIA + + C +C L E L L++ M+K KE DK +D Sbjct: 53 GFLYSIERWERIAEVEKIVCNACKEICLGLREEELLGLLAEGGMKKTLKEEFSEDKAKDA 112 Query: 375 QYLGKMKQSDDRLL 334 +YL + D LL Sbjct: 113 RYLEYIVVDDVLLL 126
>KRA11_HUMAN (Q07627) Keratin-associated protein 1-1 (Keratin-associated protein| 1.1) (High sulfur keratin-associated protein 1.1) (Keratin-associated protein 1.6) (Keratin-associated protein 1.7) Length = 177 Score = 29.6 bits (65), Expect = 7.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 599 CCRPSCSWTSSCG*G 555 CC+PSC TSSCG G Sbjct: 80 CCQPSCYQTSSCGTG 94
>KRA15_HUMAN (Q9BYS1) Keratin-associated protein 1-5 (Keratin-associated protein| 1.5) (High sulfur keratin-associated protein 1.5) Length = 174 Score = 29.3 bits (64), Expect = 10.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 599 CCRPSCSWTSSCG*GDRGFTRTRSARTASPGYPS 498 CC+PSC TS C + RS +T+ G+PS Sbjct: 24 CCQPSCCETSCC--------QPRSCQTSFCGFPS 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,900,858 Number of Sequences: 219361 Number of extensions: 1503225 Number of successful extensions: 5733 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5618 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)