| Clone Name | baal41j24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ITAE_MOUSE (Q60677) Integrin alpha-E precursor (Integrin alpha M... | 29 | 3.4 | 2 | YND4_YEAST (P53963) Hypothetical 69.4 kDa protein in NCE3-HHT2 i... | 28 | 7.6 | 3 | AOX2_AERPE (Q9YDX7) Heme-copper oxidase subunit 2 (EC 1.9.3.-) (... | 27 | 10.0 |
|---|
>ITAE_MOUSE (Q60677) Integrin alpha-E precursor (Integrin alpha M290) (CD103| antigen) [Contains: Integrin alpha-E light chain; Integrin alpha-E heavy chain] Length = 1167 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/64 (29%), Positives = 28/64 (43%) Frame = -2 Query: 265 TNNDSFNMQKEPTFTRNRALRP*RALQNKSIQSPTLVLISLRWPTVPSSTSALSYSAGHQ 86 T N S E ++ N AL R LQ K IQ P + P +S ++ GH Sbjct: 844 TMNISLTNSGEDSYMTNMALNYPRNLQFKKIQKPVSPDVQCDDPKPVASVLVMNCKIGHP 903 Query: 85 VLQQ 74 +L++ Sbjct: 904 ILKR 907
>YND4_YEAST (P53963) Hypothetical 69.4 kDa protein in NCE3-HHT2 intergenic| region Length = 612 Score = 27.7 bits (60), Expect = 7.6 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -2 Query: 259 NDSFNMQKEPTFTRNRALRP*RALQ-NKSIQSPTLVLISLRWPTVPSSTSALSYSA 95 NDS N+ + + NRA+ P +Q N + SPT S +VPS TS++S S+ Sbjct: 155 NDSCNVMLSSS-SHNRAMLPPSLVQRNNATTSPTTDSASENNESVPSLTSSVSTSS 209
>AOX2_AERPE (Q9YDX7) Heme-copper oxidase subunit 2 (EC 1.9.3.-) (Heme-copper| oxidase subunit II) Length = 234 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 149 DKHQRWRLYRLILQSPLRSKRPVSSKSRFFLHVEAVIV 262 D+ R+YR++++S PVS KS++ L V +IV Sbjct: 49 DQGTAGRIYRIMVES------PVSGKSKYLLFVTGIIV 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,802,584 Number of Sequences: 219361 Number of extensions: 649525 Number of successful extensions: 1732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)