| Clone Name | baal41j16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AROC_BARHE (Q6G4D4) Chorismate synthase (EC 4.2.3.5) (5-enolpyru... | 28 | 5.4 |
|---|
>AROC_BARHE (Q6G4D4) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 366 Score = 28.5 bits (62), Expect = 5.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 134 PGITXXSQAVTSYLNRPRATLSSHCARRREL 42 PGIT + SYLN+ + S + +RREL Sbjct: 32 PGITFTLSDIQSYLNKRKPGQSKYTTQRREL 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,627,095 Number of Sequences: 219361 Number of extensions: 171347 Number of successful extensions: 431 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)