| Clone Name | baal41g16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PSD6_ORYSA (Q8W425) 26S proteasome non-ATPase regulatory subunit... | 73 | 3e-13 | 2 | PSD6_ARATH (Q93Y35) Probable 26S proteasome non-ATPase regulator... | 54 | 1e-07 | 3 | PSD6_CAEEL (Q20585) 26S proteasome non-ATPase regulatory subunit... | 30 | 1.4 |
|---|
>PSD6_ORYSA (Q8W425) 26S proteasome non-ATPase regulatory subunit 6 (26S| proteasome regulatory particle non-ATPase subunit 7) (OsRPN7) Length = 389 Score = 72.8 bits (177), Expect = 3e-13 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +1 Query: 1 LLAHKLFLLSHPDVDDLSKVDIRSDVLSAVKSDDMAPLFES 123 +LAHKLFLLSHPDVDDL+KVD+R+DVL+AVKSDDMA L+ES Sbjct: 16 VLAHKLFLLSHPDVDDLAKVDLRADVLAAVKSDDMASLYES 56
>PSD6_ARATH (Q93Y35) Probable 26S proteasome non-ATPase regulatory subunit 6| Length = 387 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = +1 Query: 1 LLAHKLFLLSHPDVDDLSKVDIRSDVLSAVKSDDMAPLFES 123 +LA+KLFLL+HPDV D+ KV ++S+VL ++S MAPL+E+ Sbjct: 14 ILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYET 54
>PSD6_CAEEL (Q20585) 26S proteasome non-ATPase regulatory subunit 6 (26S| proteasome regulatory subunit rpn-7) Length = 410 Score = 30.4 bits (67), Expect = 1.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 4 LAHKLFLLSHPDVDDLSKVDIRSDVLSAVKSDDMAPLFE 120 L+ F+L+HP+VD K + +K DMAP +E Sbjct: 31 LSQTRFMLNHPEVDSSVKEAKLEKLQETIKEFDMAPFYE 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,554,597 Number of Sequences: 219361 Number of extensions: 79857 Number of successful extensions: 417 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)