| Clone Name | baal41e14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MSI4_ARATH (O22607) WD-40 repeat protein MSI4 (Altered cold-resp... | 121 | 4e-28 | 2 | MSI5_ARATH (Q9SU78) WD-40 repeat protein MSI5 | 69 | 4e-12 | 3 | RENT1_FUGRU (Q98TR3) Putative regulator of nonsense transcripts ... | 29 | 3.0 | 4 | YIS5_SHISO (P16943) Insertion element IS630 hypothetical 39 kDa ... | 28 | 6.7 |
|---|
>MSI4_ARATH (O22607) WD-40 repeat protein MSI4 (Altered cold-responsive gene 1| protein) Length = 507 Score = 121 bits (304), Expect = 4e-28 Identities = 58/59 (98%), Positives = 58/59 (98%) Frame = +3 Query: 3 WGPQFEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPF 179 WGPQ EQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPF Sbjct: 96 WGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPF 154
>MSI5_ARATH (Q9SU78) WD-40 repeat protein MSI5| Length = 487 Score = 68.6 bits (166), Expect = 4e-12 Identities = 38/59 (64%), Positives = 40/59 (67%) Frame = +3 Query: 3 WGPQFEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPF 179 WGPQ EQA K QRLYLSEQT+GSVPNTLVIANCE V Q NE+A SPF Sbjct: 86 WGPQLEQAGSKT-QRLYLSEQTNGSVPNTLVIANCETVN---------RQLNEKAHSPF 134
>RENT1_FUGRU (Q98TR3) Putative regulator of nonsense transcripts 1 (EC 3.6.1.-)| (ATP-dependent helicase RENT1) Length = 1097 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 175 GDRASSLNCDMCSAAATRGLTTSQFAMTRVLGTLP 71 G+ +S +C MC AA GL+ S F VLG P Sbjct: 642 GEITASWSCVMCKKAAKAGLSQSLFERLVVLGIRP 676
>YIS5_SHISO (P16943) Insertion element IS630 hypothetical 39 kDa protein| (ISO-IS200 39 kDa protein) Length = 343 Score = 28.1 bits (61), Expect = 6.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 178 KGDRASSLNCDMCSAAATRGLTTSQFAMTRVLGTLPSVCSDR*RRWRF 35 +GDR S + +C A ++ G + F + V G L S+ + R RRW F Sbjct: 39 RGDRVSDVARTLCCARSSVGRWINWFTQSGVEG-LKSLPAGRARRWPF 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.129 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,017,463 Number of Sequences: 219361 Number of extensions: 404370 Number of successful extensions: 1240 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)