| Clone Name | baal40n11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y2434_MYCBO (P65002) Hypothetical protein Mb2434c | 28 | 8.3 | 2 | Y2411_MYCTU (P65001) Hypothetical protein Rv2411c/MT2484 | 28 | 8.3 |
|---|
>Y2434_MYCBO (P65002) Hypothetical protein Mb2434c| Length = 551 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 234 VDTGVNQVLPASSCTCHDQAITYHVPRD*VTPRPLITSTCHHH 106 ++ G+ Q + A C D + RD V PR L+TS H H Sbjct: 111 LERGITQRVKALECYLDDIYGDQEILRDGVIPRRLVTSCEHFH 153
>Y2411_MYCTU (P65001) Hypothetical protein Rv2411c/MT2484| Length = 551 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 234 VDTGVNQVLPASSCTCHDQAITYHVPRD*VTPRPLITSTCHHH 106 ++ G+ Q + A C D + RD V PR L+TS H H Sbjct: 111 LERGITQRVKALECYLDDIYGDQEILRDGVIPRRLVTSCEHFH 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,513,770 Number of Sequences: 219361 Number of extensions: 1071196 Number of successful extensions: 1917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1911 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)