| Clone Name | baal41c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CPK15_ARATH (P92937) CBL-interacting serine/threonine-protein ki... | 35 | 0.18 | 2 | HCN4_HUMAN (Q9Y3Q4) Potassium/sodium hyperpolarization-activated... | 32 | 1.5 | 3 | UVRC_COLP3 (Q47Z18) UvrABC system protein C (Protein uvrC) (Exci... | 32 | 1.9 | 4 | XPSM_XANCP (P29039) Protein xpsM | 30 | 4.3 | 5 | BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associa... | 30 | 7.4 | 6 | TEGP_BHV1S (Q08098) Probable tegument protein | 29 | 9.7 |
|---|
>CPK15_ARATH (P92937) CBL-interacting serine/threonine-protein kinase 15 (EC| 2.7.11.1) (Serine/threonine-protein kinase ATPK10) (SOS2-like protein kinase PKS3) (SOS-interacting protein 2) (SNF1-related kinase 3.1) Length = 421 Score = 35.0 bits (79), Expect = 0.18 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +3 Query: 555 EQKGNILMHKYEMGKMLGQGT 617 E+KG++LM +YE+GK LGQGT Sbjct: 2 EKKGSVLMLRYEVGKFLGQGT 22
>HCN4_HUMAN (Q9Y3Q4) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 Length = 1203 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +2 Query: 143 SGGSDPPPRCCGLRSRPSPAAGICILISTRRNHLRECREMCLHARELP 286 S S PPP CG S P+P+AG+ H + L + + P Sbjct: 877 SSSSSPPPGACGSPSAPTPSAGVAATTIAGFGHFHKALGGSLSSSDSP 924
>UVRC_COLP3 (Q47Z18) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 639 Score = 31.6 bits (70), Expect = 1.9 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 242 LRECREMCLHARELPC--EGIGRVAAPLSALIDLDDTASQHHTAHLF 376 +R+C + AR PC +GR +AP I +DD Q + A LF Sbjct: 166 IRQCEDSYYRARSRPCLQHQLGRCSAPCVDKISVDDYKEQVNLAKLF 212
>XPSM_XANCP (P29039) Protein xpsM| Length = 237 Score = 30.4 bits (67), Expect = 4.3 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -2 Query: 477 PAGAGWPQPSPPRW*SKMMVEMPRRTPLCRSTWKKR 370 PA PSPP W V MPRR P+ RS + R Sbjct: 2 PAATWTASPSPPNW----PVPMPRRPPMPRSVKRDR 33
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 29.6 bits (65), Expect = 7.4 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 573 EYSPSAPP*WQAGRQADVHRKKQQRSRELAREPAGAGWPQPSPP 442 +Y S PP +Q +Q + +++QQ+ + ++ G P P PP Sbjct: 637 KYQKSLPPRFQRQQQEQLLKQQQQQQWQQQQQQQGTAPPAPVPP 680
>TEGP_BHV1S (Q08098) Probable tegument protein| Length = 158 Score = 29.3 bits (64), Expect = 9.7 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +2 Query: 146 GGSDPPPRC---CGLRSRPSPAAGICILISTRRNHLRECREMCLHARELPCEGIGRVAAP 316 GG P P C S AG ++ R+ R R C+ A L C G+G AA Sbjct: 84 GGYVPVPAADADCYYSESDSETAGEFLIRMGRQQRRRHRRRRCMIAAALTCIGLGACAAA 143 Query: 317 LSA 325 +A Sbjct: 144 AAA 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,648,117 Number of Sequences: 219361 Number of extensions: 1671892 Number of successful extensions: 5338 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5325 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)