| Clone Name | baal40g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FSCN3_HUMAN (Q9NQT6) Fascin-3 (Testis fascin) | 28 | 8.6 | 2 | SYK_HUMAN (Q15046) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--t... | 28 | 8.6 | 3 | SYK_CRIGR (P37879) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--t... | 28 | 8.6 |
|---|
>FSCN3_HUMAN (Q9NQT6) Fascin-3 (Testis fascin)| Length = 498 Score = 28.5 bits (62), Expect = 8.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 228 TLACLDDTGISSSRLDVDPHDRF*SLHCLCNYHLCTRLQVWIPKPPLH 371 TL CL IS L+ + D F + H L YH+ W P+P LH Sbjct: 106 TLQCL----ISGRYLESNGKDVFCTSHVLSAYHM------WTPRPALH 143
>SYK_HUMAN (Q15046) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 597 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 354 GSRLVVLYTSGNYKGSEEIKNDHGDPRRGDLMICQYHQG 238 G +L V+ S NYK EE + + RRGD++ Q + G Sbjct: 151 GVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPG 189
>SYK_CRIGR (P37879) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 597 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 354 GSRLVVLYTSGNYKGSEEIKNDHGDPRRGDLMICQYHQG 238 G +L V+ S NYK EE + RRGD++ Q + G Sbjct: 151 GVKLQVMANSRNYKSEEEFVRINNKLRRGDIIGVQGNPG 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,919,232 Number of Sequences: 219361 Number of extensions: 965879 Number of successful extensions: 2390 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2390 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)