| Clone Name | baal40d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAHC_HORVU (P40880) Carbonic anhydrase, chloroplast precursor (E... | 74 | 8e-14 | 2 | SNX41_CRYNE (Q5KKB9) Sorting nexin-41 | 28 | 6.7 | 3 | MTGA_AGRT5 (Q8UBX8) Monofunctional biosynthetic peptidoglycan tr... | 28 | 8.8 |
|---|
>CAHC_HORVU (P40880) Carbonic anhydrase, chloroplast precursor (EC 4.2.1.1)| (Carbonate dehydratase) Length = 324 Score = 74.3 bits (181), Expect = 8e-14 Identities = 40/56 (71%), Positives = 40/56 (71%) Frame = +3 Query: 15 APRARSSTIAASLGTPAPSSSASFRPKLIRTTXXXXXXXXXXXXXXXXERLKTGFE 182 APRARSSTIAASLGTPAPSSSASFRPKLIRTT ERLKTGFE Sbjct: 80 APRARSSTIAASLGTPAPSSSASFRPKLIRTTPVQAAPVAPALMDAAVERLKTGFE 135
>SNX41_CRYNE (Q5KKB9) Sorting nexin-41| Length = 638 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 9 PXAPRARSSTIAASLGTPAPSSSASF 86 P PR SS ++A+ G+P P+ ASF Sbjct: 26 PPVPRKPSSLVSAASGSPPPTHRASF 51
>MTGA_AGRT5 (Q8UBX8) Monofunctional biosynthetic peptidoglycan transglycosylase| (EC 2.4.2.-) (Monofunctional TGase) Length = 226 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 79 AEEEGAGVPRLAAMVEERARGAXGCV 2 A + G G+ RLA ++E RAR + G V Sbjct: 196 ASKPGRGLQRLAGLIERRARASGGYV 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,740,682 Number of Sequences: 219361 Number of extensions: 121718 Number of successful extensions: 775 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)