| Clone Name | baal40c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CTPA_SYNY3 (Q55669) Carboxyl-terminal-processing protease precur... | 39 | 0.005 | 2 | YPEB_SYNP2 (P42784) Hypothetical protein in petB 5'region (Fragm... | 35 | 0.043 | 3 | RPOB_NEPOL (Q9TL06) DNA-directed RNA polymerase beta chain (EC 2... | 30 | 2.3 | 4 | RECG_SYNY3 (Q55681) ATP-dependent DNA helicase recG (EC 3.6.1.-) | 28 | 8.9 |
|---|
>CTPA_SYNY3 (Q55669) Carboxyl-terminal-processing protease precursor (EC| 3.4.21.102) Length = 427 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +3 Query: 39 TPSPSPRTREVNRVQRTLVEAWGLIRETFVDPTFNHQDW 155 TPS T E Q+ L+++W L+ ++++D TFNHQ+W Sbjct: 26 TPSALAFTEE----QKLLLQSWRLVNQSYLDETFNHQNW 60
>YPEB_SYNP2 (P42784) Hypothetical protein in petB 5'region (Fragment)| Length = 411 Score = 35.4 bits (80), Expect = 0.043 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 48 PSPRTREVNRVQRTLVEAWGLIRETFVDPTFNHQDW 155 P R Q L++AW + + +VD TFNHQ+W Sbjct: 23 PMERAIAFTDEQDLLLQAWRYVSQAYVDETFNHQNW 58
>RPOB_NEPOL (Q9TL06) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta subunit) (RNA polymerase beta subunit) Length = 1109 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 116 TDQPPCLHQRPLHPVHLSGPWRRGRRTVSDSARAGGGV 3 ++Q C+HQRP+ P+H P RG S+ +GG + Sbjct: 655 SNQGTCIHQRPIIPLHT--PVIRGDLLADGSSTSGGQI 690
>RECG_SYNY3 (Q55681) ATP-dependent DNA helicase recG (EC 3.6.1.-)| Length = 831 Score = 27.7 bits (60), Expect = 8.9 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 21 GRVAHRTPSPSPRTREVNRVQRTLVEAWGLIR--ETFVDPTFNHQDWDQKLQ 170 GRV + T SP+ + +N +Q L + G I+ + F H+ W +K++ Sbjct: 193 GRVVNCTCFTSPKNQNLNILQIQLRDQTGRIKLSRFYAGKRFAHRGWQEKIK 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,269,513 Number of Sequences: 219361 Number of extensions: 266887 Number of successful extensions: 1030 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)