| Clone Name | baal40c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Unco... | 31 | 1.6 | 2 | PP28_HCMVA (P13200) Tegument protein UL99 (28 kDa structural pho... | 30 | 3.6 | 3 | RRN6_YEAST (P32786) RNA polymerase I-specific transcription init... | 29 | 6.2 |
|---|
>UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Uncoordinated protein| 89) Length = 8081 Score = 31.2 bits (69), Expect = 1.6 Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 15/73 (20%) Frame = +3 Query: 207 EIADPVIKDKAAMPVLKKDKNPKS---------------SGPAKRKRTPTLEDEKAMPYK 341 E+ P K+K+ KK+K+P S P K++++P ++ P K Sbjct: 1426 EVKSPTKKEKSPSSPTKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVK 1485 Query: 342 SEKLQNDSTVIDM 380 EK + + ++++ Sbjct: 1486 KEKSPDATNIVEV 1498
>PP28_HCMVA (P13200) Tegument protein UL99 (28 kDa structural phosphoprotein)| (PP28) Length = 189 Score = 30.0 bits (66), Expect = 3.6 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 228 KDKAAMPVLKKDKNPKSSGPAKRKRTPTL---EDEKAMPYKSEKLQNDSTVIDMGPP 389 K A ++DK PK S +K+K+ P+ + ++ +++ L + T I + PP Sbjct: 89 KKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPP 145
>RRN6_YEAST (P32786) RNA polymerase I-specific transcription initiation factor| RRN6 Length = 894 Score = 29.3 bits (64), Expect = 6.2 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 264 KNPKSSGPAKRKRTPTLEDEKAMPYKSEKLQNDSTVIDMGPPA 392 K+ +SSG A+RKR + +KA P S+ QN S + D PA Sbjct: 817 KSSQSSGLARRKRILKTQSQKATPL-SQSTQNLSVLPDSMTPA 858 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,909,938 Number of Sequences: 219361 Number of extensions: 1066295 Number of successful extensions: 2732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2729 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)