| Clone Name | baal39o12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DYRK3_DROME (P83102) Putative dual specificity tyrosine-phosphor... | 31 | 1.6 | 2 | RL16_MYCGE (P47404) 50S ribosomal protein L16 | 31 | 2.1 | 3 | RL16_MYCPN (P41204) 50S ribosomal protein L16 | 30 | 2.7 | 4 | HOW_DROME (O01367) Protein held out wings (KH-domain protein KH9... | 30 | 3.6 |
|---|
>DYRK3_DROME (P83102) Putative dual specificity| tyrosine-phosphorylation-regulated kinase 3 homolog (EC 2.7.12.1) Length = 828 Score = 31.2 bits (69), Expect = 1.6 Identities = 24/76 (31%), Positives = 35/76 (46%) Frame = -3 Query: 285 PTNLPEKTLRPPPRQLETAGNSLIRREASNQQQIRDAGLADRNVRAQIQLPRVFAPRSPQ 106 PT+LP+ ++ + L G + E +N+ Q RD+GL L R F P Sbjct: 42 PTSLPQIQIQMINQNLTHTGIAQNNTEKANRHQYRDSGLQ--------YLTRCF---EPL 90 Query: 105 AQLTDQKEKSASQIAN 58 A L D KE +Q +N Sbjct: 91 AMLNDSKEDFPTQPSN 106
>RL16_MYCGE (P47404) 50S ribosomal protein L16| Length = 138 Score = 30.8 bits (68), Expect = 2.1 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 104 ACGDLG-ANTRGSWICARTFRSARPASRICC*FDASRRIRLFPAVS 238 A G+ G T+G+WI AR SAR A C IR+FP +S Sbjct: 28 AFGEYGIVATKGNWIDARAIESARVAISKCLGKTGKMWIRIFPHMS 73
>RL16_MYCPN (P41204) 50S ribosomal protein L16| Length = 139 Score = 30.4 bits (67), Expect = 2.7 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 104 ACGDLG-ANTRGSWICARTFRSARPASRICC*FDASRRIRLFPAVS 238 A G+ G T+G+WI AR SAR A C IR+FP +S Sbjct: 28 AFGEYGLVATKGNWIDARAIESARIAISKCLGKTGKMWIRIFPHMS 73
>HOW_DROME (O01367) Protein held out wings (KH-domain protein KH93F) (Putative| RNA-binding protein) (Protein muscle-specific) (Protein wings held out) (Protein struthio) (Quaking-related 93F) Length = 405 Score = 30.0 bits (66), Expect = 3.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -3 Query: 201 SNQQQIRDAGLADRNVRAQIQLPRVFAPRSPQAQLTDQKEKSASQIAN 58 + QQQ + A + Q Q P+V P +PQ Q+++S IA+ Sbjct: 30 AQQQQAQAQAQAQAQAQQQQQAPQVVVPMTPQHLTPQQQQQSTQSIAD 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,479,734 Number of Sequences: 219361 Number of extensions: 1133083 Number of successful extensions: 3097 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3097 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)