| Clone Name | baal39m10 |
|---|---|
| Clone Library Name | barley_pub |
>NUDH_BORPE (Q7VTZ7) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = -2 Query: 215 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 114 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORPA (Q7W482) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = -2 Query: 215 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 114 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORBR (Q7WFP0) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = -2 Query: 215 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 114 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>CDC2H_THEPA (Q27032) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 298 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 226 YKSQNRHCSVCTRKQVRISE 167 YK+QN H +C K++R+ E Sbjct: 19 YKAQNNHGEICALKKIRVEE 38
>CDC2H_THEAN (Q26671) Cell division control protein 2 homolog (EC 2.7.11.22) (EC| 2.7.11.23) Length = 298 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 226 YKSQNRHCSVCTRKQVRISE 167 YK+QN H +C K++R+ E Sbjct: 19 YKAQNNHGEICALKKIRVEE 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,629,238 Number of Sequences: 219361 Number of extensions: 620368 Number of successful extensions: 1328 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)