| Clone Name | baal39b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC... | 28 | 9.0 | 2 | GIS4_YEAST (Q04233) Protein GIS4 | 28 | 9.0 |
|---|
>PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC 1.10.3.1)| (PPO) (Catechol oxidase) Length = 593 Score = 27.7 bits (60), Expect = 9.0 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 3 DSIYIYV*FP-F*FSPHSRYLCFPFHFYYVY 92 D Y V FP H+ +L FPFH YY+Y Sbjct: 180 DGAYDQVGFPELELQIHNSWLFFPFHRYYLY 210
>GIS4_YEAST (Q04233) Protein GIS4| Length = 774 Score = 27.7 bits (60), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 99 TMNRHNKNEKGNKDSGSEEKIRK 31 T N H N KGN +S S+ +++K Sbjct: 682 TKNSHKPNSKGNNESNSKNELKK 704 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,600,620 Number of Sequences: 219361 Number of extensions: 229463 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)