| Clone Name | baal38i04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CASB_PIG (P39037) Beta-casein precursor | 30 | 2.4 | 2 | SYK_AERPE (Q9YFT9) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--t... | 28 | 9.1 | 3 | MYB2_PHYPA (P80073) Myb-related protein Pp2 | 28 | 9.1 |
|---|
>CASB_PIG (P39037) Beta-casein precursor| Length = 232 Score = 29.6 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -1 Query: 115 RSMXMSTLL---DPAASPARGILPVPEPSRPVSLPI 17 R M LL DP P +G PVP+P PV P+ Sbjct: 197 RDMPFQALLLYQDPLLGPLQGFYPVPQPVAPVYNPV 232
>SYK_AERPE (Q9YFT9) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 562 Score = 27.7 bits (60), Expect = 9.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 1 PSAXQR*GGRPXEKVPEPEGC 63 P A +R G P ++VP+P+GC Sbjct: 105 PKAAERYVGWPLDRVPDPKGC 125
>MYB2_PHYPA (P80073) Myb-related protein Pp2| Length = 421 Score = 27.7 bits (60), Expect = 9.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 136 RLSSGLPRSMXMSTLLDPAASPARGILPVPEP 41 +L+SGLP+ +++ ASP +G+LP P Sbjct: 297 QLNSGLPKLEDVNSKSSAVASPVQGMLPAYNP 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,187,958 Number of Sequences: 219361 Number of extensions: 155177 Number of successful extensions: 1111 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)