| Clone Name | baal37h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NPAS1_HUMAN (Q99742) Neuronal PAS domain protein 1 (Neuronal PAS... | 32 | 2.6 | 2 | TSC1_RAT (Q9Z136) Hamartin (Tuberous sclerosis 1 protein homolog) | 30 | 5.9 |
|---|
>NPAS1_HUMAN (Q99742) Neuronal PAS domain protein 1 (Neuronal PAS1) (Member of| PAS protein 5) (MOP5) Length = 590 Score = 31.6 bits (70), Expect = 2.6 Identities = 21/63 (33%), Positives = 27/63 (42%) Frame = +1 Query: 259 WTQALQPAQGQGHRAALPGDHRVLQDHRR*PQAEAGLDPPRQEERREARIPCLTSQSPLP 438 W Q++ G G PG+H VL QAE G P + A + C + SP P Sbjct: 379 WLQSVATVAGSGKS---PGEHHVLWVSHVLSQAEGG-QTPLDAFQLPASVACEEASSPGP 434 Query: 439 SPT 447 PT Sbjct: 435 EPT 437
>TSC1_RAT (Q9Z136) Hamartin (Tuberous sclerosis 1 protein homolog)| Length = 1163 Score = 30.4 bits (67), Expect = 5.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 349 PQAEAGLDPPRQEERREARIPCLTSQSPLPS 441 P ++A PPR+EER ++ P L Q +PS Sbjct: 410 PASQASATPPRKEERADSSRPYLPRQQDVPS 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,720,242 Number of Sequences: 219361 Number of extensions: 1613724 Number of successful extensions: 4660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4657 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7592921998 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)