| Clone Name | baal36d21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HYPA_CLOPE (Q46205) Protein hypA | 47 | 2e-05 | 2 | DLX5_CHICK (P50577) Homeobox protein DLX-5 (cDlx) | 28 | 8.9 |
|---|
>HYPA_CLOPE (Q46205) Protein hypA| Length = 973 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/54 (38%), Positives = 31/54 (57%) Frame = +2 Query: 5 NEAIVIPTQVNYVGKXGNPXQSGYQLNGSAYVISKHISNTWLWDRVRVXGGAYG 166 NE ++ V YV K GN GY+ +G+ ++ + +LW+ VRV GGAYG Sbjct: 783 NEGLLTQGNVQYVAKGGNYKTHGYKYSGALSLLESILGFDYLWNAVRVKGGAYG 836
>DLX5_CHICK (P50577) Homeobox protein DLX-5 (cDlx)| Length = 286 Score = 27.7 bits (60), Expect = 8.9 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 23 PTQVNYVGKXGNPXQSGYQLNGSAYVI-SKHISNTWLWDRVRVXGGAYG 166 PT +Y GK NP Q Y +NGSA +K ++ GGAYG Sbjct: 61 PTSASY-GKALNPYQYQYGMNGSAGTYPAKAYADYGYGSPYHQYGGAYG 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,689,717 Number of Sequences: 219361 Number of extensions: 358558 Number of successful extensions: 927 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)